yume nishinomiya




FC2HODVHNDMVSDSHKDJULMILKVEMAGMEMSQTEDTTGVHWAAASSISNNPJPPPDSSNICJODAUKSSDABROYD

2020-11-24
65 min

FC2PPV 1582214 A beautiful woman with many mysteries I went to shoot again for money … I couldn’t contact her after that.

  • amateur uncensoredfc2
    • 2020-11-26
    66 min

    336KNB-130 “I want to lengthen both foreplay and production! ] A wife who is too greedy for sex is not satisfied with sex with her husband and applies for AV! !! Unfaithful sex where a dirty wife who can cum inside if it feels good is in agony w

  • amateur censoredcreampiemarried womanknbknb-130knb130336knb-130
    • 2020-12-02
    481 min

    [RVG-124]Anal Device Bondage Best Of Anal Play In Chains vol. 2

  • yuria tsukino nozomi hazuki censoredRVGglory questRVG-124RVG12413rvg00124
    • 2020-12-17
    120 min

    [OKSN-313]A Captive To My Lover's Huge Cock - Lost To My Craven Lusts

  • censoredbeautiful girlOKSNabc mousouzokuokasan.comOKSN-313OKSN313oksn00313
    • 2020-12-22
    124 min

    [IBW-807]Video Of Rough Sex In A Women's Public Toilet

  • amateur censoredIBWi b worksIBW-807IBW807
    • 2020-12-23
    69 min

    FC2PPV 1617348 [First shot] Etch likes chew ❤️❤️ I was able to make a vaginal cum shot with OL and Icharab SEX that exudes eroticism ❤️❤️

  • amateur uncensoredfc2
    • 2020-12-27
    150 min

    [LULU-052]While Her Husband Was Dispatched To A Faraway Outpost, I Fell So In Love With My Big Tits Auntie's Luscious Boobs That We Locked Ourselves In And Creampie Fucked Until She Was Surely Pregnant Ayane Sezaki

  • ayane sezaki censoredcreampiebig titsLULUlunaticsluminaxLULU-052LULU052lulu00052
    • 2021-01-09
    123 min

    [MIAA-379]I Was Pissed Off After Getting Fired From My Job, So I Tied Up My Bitchy Lady Boss And Pumped Her Full Of Aphrodisiacs And Fucked Her... At Least, That Was The Plan, Until She Transformed Into A Horny Slut, While She Was Tied Up! I Thought

  • hasumi claire censoredcreampieslutMIAAmoodyzmiyoshi rushereveryone s porn starMIAA-379MIAA379miaa00379
    • 2021-01-10
    151 min

    [CHRV-123]The Maso Equation Maso Horny Areolas + Masso Nipples = Maso Titties I Love My Sadistic Big Stepbrother! This Little Stepsister Has Colossal Tits Worth More Than Just A Single Look And Proves It With Her Boobs! K-Cup 119cm Titties Yurippe

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-123CHRV123chrv00123
    • 2021-01-24
    54 min

    299EWDX-342 A wife with a neat face and a big gap under her dress wearing underwear.

  • amateur censoredcreampiebig titsewdxewdx-342ewdx342299ewdx-342
    • 2021-01-26
    140 min

    [SDNM-266]A 120 Natural Airhead Beautiful Married Woman Who is Even More Clear And Pure Than The Spring Waters Of The Southern Alps Kanna Hirai 34 Years Old The Final Chapter "Today Will Be The Last Time" Creampie Raw Footage Of A 2-Day, 1-Ni

  • shiori hirai censoredcreampiemature womanSDNMsod createcompany matsuogenuine married woman the porn experienSDNM-266SDNM2661sdnm00266
    • 2021-01-30
    236 min

    [CLUB-628]The Treatment room which the Female Teacher uses for Chiropratic Therapy 28

  • censoredCLUBhentai shinshi clubCLUB-628CLUB628club00628
    • 2021-01-31
    37 min

    493PKPD-089 [Leaked] Overrun a cool beauty with a big cock! NTR trip out in 1 night 2 days without telling boyfriend

  • amateur censoredamateurbeautiful girlpkpdpkpd-089pkpd089493pkpd-089
    • 2021-02-06
    114 min

    [ADN-295]I Know My Husband's Cheating, So I Fuck My Boss All I Want - And It Feels So Good I Can't Stop. Hikari Ninomiya

  • hikari ninomiya censoredsingle workdramaADNattackerssadao sadaokaotona no dramaADN-295ADN295adn00295
    • 2021-02-07
    59 min

    HEYZO 2454 Busty Married Wife’s Affair Vol.2 – Madoka Ayakawa

  • madoka ayakawa uncensoredcreampieheyzo
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    110 min

    [FSDSS-166]My New Wife - Sora Fucks Like A Slut, Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-166FSDSS1661fsdss00166
    • 2021-02-17
    137 min

    [GVH-194]Trip With My Sexy Big-Titty Teacher! Exciting Three Day School Trip To The Hot Springs Yuria Yoshine

  • yoshine yuria censoredbig titsGVHglory questhyonGVH-194GVH19413gvh00194
    • 2021-02-24
    99 min

    459TEN-013 [Final Weapon H Cup] Bring a god milk gal with maximum destructive power to the hotel! !! Bombshell fuck with gal’s special game underwear! !! The strongest boyne of weight MAX riding on a flat waist is too erotic! !! Put it in, rub i

  • amateur censoredcreampiebig titstenten-013ten013459ten-013
    • 2021-02-27

    H0930 ki210227 piddle 20years old

  • amateur uncensoredh0930
    • 2021-02-28
    101 min

    [VEMA-157]She's My Beautiful Female Teacher, My Class Leader, My Club Advisor, And My Girlfriend - Forbidden Creampie Sex From Morning Until Night - Rin Azuma

  • dongguan censoredcreampiemature womanVEMAvenusbingo tamatsukamegami venusVEMA-157VEMA157vema00157
    • 2021-03-04
    61 min

    [loli-034]えり 2

  • amateur censoredcreampieamateurloliloli-034loli034loli-034
    • 2021-03-05
    41 min

    416SVMM-046 Nene

  • amateur censoredcreampiesquirtingsvmmsvmm-046svmm046416svmm-046
    • 2021-03-09
    50 min

    10musume 030921_01 Women begin to seek dicks herself with the technique of women-only delivery esthetics TAKIZAWAREI

  • amateur uncensored10musume
    • 2021-03-10
    55 min

    326HGP-019 This woman is amazing! !! Capture a drunken G milk student from early morning after the cabaret bite ☆ Bring it to the hotel and insert unauthorized raw! A climax trance on the verge of hyperventilation of the G cup swaying with a series o

  • amateur censoredcreampiebig titshgphgp-019hgp019326hgp-019
    • 2021-03-18
    477 min

    [OFJE-303]Saki Okuda - S1 - 8 Hours - The Best Scenes From Her 12 Latest Titles vol. 7

  • saki okuda censoredbig titssingle workOFJEs1 no 1 styleOFJE-303OFJE303ofje00303
    • 2021-03-19
    142 min

    [MRSS-108]The Son Of My Cruel Boss Came To My House And Fucked My Wife After Making Fun Of My House Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-108MRSS108mrss00108
    • 2021-03-23
    63 min

    345SIMM-625 Yariman Nasty Gal Mama Brushes A Big Penis Virgin!

  • amateur censoredcreampiebig titssimmsimm-625simm625345simm-625
    • 2021-03-26
    115 min

    [SGA-148]Best Ever Raw Sex With The Best Ever Lover 62 Ubelievably Beautiful E-Cup Tits On A Slender Body

  • censoredcreampieamateurSGAsetsugekkaprestigeSGA-148SGA148118sga00148
    • 2021-04-02
    37 min

    HEYZO 2521 Creampie in America #Hannah – Hannah

  • hannah uncensoredheyzo
    • 2021-04-02
    91 min

    380SQB-095 Shou

  • amateur censoredamateurbeautiful girlsqbsqb-095sqb095380sqb-095
    • 2021-04-03
    59 min

    188HINT-0448 Kiyoka

  • amateur censoredcreampiemarried womanhinthint-0448hint0448188hint-0448
    • 2021-04-09
    139 min

    [SKMJ-157]Only The Purest Amateurs Win! Sensitive College Girl From Fukuoka Makes Her Porn Debut Suzu Takayama

  • takayama tin censoredblowjobbeautiful girlSKMJred face girlone topSKMJ-157SKMJ157h-1324skmj00157
    • 2021-05-07
    123 min

    [IPX-665]I Hate My Boss' Guts, But Now We're On A Business Trip Together, And To My Shock And Horror, We've Been Booked Into The Same Room At The Hot Spring Resort Inn ... This Ugly And Disgusting Horny Old Man Made Me Cum Over And Over A

  • airi kijima censoredcreampiesingle workIPXidea pocketdishIPX-665IPX665ipx00665
    • 2021-05-14
    120 min

    [BLK-499]"I Can't Believe This... I Haven't Touched Myself In Ages, I'm So Wet" Desperately Horny Gal Has Her Boyfriend Cancel Their Date At The Last Minute! She's Pissed Off At Him And Ready To Cheat - Fucking A Gorgeous Gir

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-499BLK499blk00499
    • 2021-05-21
    61 min

    383REIW-066 Mizuki

  • amateur censoredcreampiebig titsreiwreiw-066reiw066383reiw-066
    • 2021-06-01
    136 min

    [KIRE-044]138000 ML Of Semen Milked With Amazing Nut-Busting Techniques - She'll Drain Four Loads In A Row, Or So Goes The Rumors About This Soapland Hooker - Miss Sumire - Sumire Kurusu

  • sumire kurusu censoredcreampiecosplayKIREsod createmid eyebeauty kirei sodKIRE-044KIRE0441kire00044
    • 2021-06-09
    64 min

    326HGP-021 [Former model receptionist x sexual oil massage] [G cup big breasts / art slender lath BODY] SSS-class superb beauty loses reason with aphrodisiac and obscenity vaginal cum shot! !!

  • amateur censoredcreampiebig titshgphgp-021hgp021326hgp-021
    • 2021-07-06
    52 min

    Caribbeancom 070621-001 Time Fuck Bandits : Let Time Stands Still This Way at Karaoke Saori Asada

  • saori asada uncensoredcreampiehandjobcaribbeancom
    • 2021-07-18
    122 min

    [AGMX-085]Fully Naked Men's Massage Parlor - The Nishi Azabu Store

  • arisa hanyu arisu hanyu hikaru minazuki censoredbig titsAGMXsex agent daydreamersusubashisuisex agentAGMX-085AGMX085agmx00085



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV