censored ass fetish high vision javcensored upskirt




FC2AWDSPRDNATRHMNFSDSSMIAADASDWAAAVENUDASDMEYDGMEMSHKDCJODSTARSMARALULUSDABCHRVVEMA

2022-01-13
95 min

[AARM-051]My Cock Got So Hard While I Was Looking At Close-up Panty Shots! I Was Just Bursting Out When She Told Me I Could Tough Her Panties!!

  • arimura nozomi rurucha censoredblowjobhandjobAARMaroma planninghamu oujiaromaAARM-051AARM051aarm00051
    • 2021-12-24
    184 min

    [HUNTB-171]Glasses x Knee-High Socks x Miniskirt x Thong This Sch**lgirl Is So Excessively Erotic, She"s Giving Me A Full-On Hard On! "I Don"t Know If I Can Make You Feel Good, But I Can Do Some Sexy Things For You ..."

  • censoredschoolgirlHUNTBhuntermorikihhh groupHUNTB-171HUNTB171huntb00171
    • 2021-11-18
    125 min

    [AARM-036]Thong Pantyhose And Raw Anal Sex That You Can Watch Closely While Shimmying.

  • narumi hirose tsukasa nagano censoredanalAARMaroma kikakusatoshimaniaaromaAARM-036AARM036aarm00036
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-22
    205 min

    [HUNTB-126]"Is That A Wedgie!" Girl With A Serious Panties Wedgie Is Just Too Hot To Resist, Leading To Hot Unbelievable Pounding From Behind With Her Sexy Ass In View!

  • censoredcreampieHUNTBhunterkonnyaku kannohhh groupHUNTB-126HUNTB126huntb00126
    • 2021-10-21
    137 min

    [PARM-169]Super Real!! Model Let Me Take Pictures Of Her Wet Panties

  • censoredbeautiful girlPARMaroma kikakumousou chirarizumuPARM-169PARM169parm00169
    • 2021-09-16
    107 min

    [AARM-017]The Pleasure Of Pressing Your Cock Against Her Fully Panty-Covered Ass And Ejaculating Like A Geyser Of Cum

  • arimura nozomi miu susaki censoredbukkakeAARMaroma kikakuhamu oujiaromaAARM-017AARM017aarm00017
    • 2021-09-09
    128 min

    [AARM-014]Thigh Job And Ass Job Over Underwear - Boys Wear Briefs Too, So Contact Area Can Be Seen Well! Part. 5

  • yui nagase mizuki yayoi censoredslutAARMaroma planninghamu oujiaromaAARM-014AARM014aarm00014
    • 2021-08-08
    121 min

    [PARM-167]Underskirt Explorers!

  • nagaoka maria okawa censoredPARMaroma kikakumousou chirarizumuPARM-167PARM167parm00167
    • 2021-07-14
    125 min

    [ARM-998]Girls Give Jerk Off Instructions In Thongs Before Showing Off What's Underneath

  • blue ai kawana censoredanalARMaroma planningmania satoshiaromaARM-998ARM998arm00998
    • 2021-05-20
    125 min

    [ARM-981]Girls Show Off Their Pussies And Anuses In Three Sexy Poses

  • mihina azumihina mihina nagai yamamoto renka censoredanalARMaroma planningmania satoshiaromaARM-981ARM981arm00981
    • 2021-05-14
    121 min

    [ARM-979]I Can Feel The Egg Vibrator Vibrating In Her Pussy Through Her Panties As She Pushes Her Crotch Onto My Cock

  • chiharu miyazawa kasagi ichika censoredARMaroma planninghamu oujiaromaARM-979ARM979arm00979
    • 2021-05-02
    141 min

    [ARM-976]Woman Rides My Face So Hard She Almost Suffocates Me With Her Pussy Hair Filled Panties

  • mitsuha higuchi hazuki peach censoredsluthandjobARMaroma planninghamu oujiaromaARM-976ARM976arm00976
    • 2021-04-09
    145 min

    [SKMJ-158]Slip Your Dick Into This Big Ass Sch**lgirl From Behind For Some Quickie Action! This Beautiful Y********l In Uniform Works Part-Time At A Housecleaning Service And When She Came To Your House You Couldn't Resist The Temptation Of Her M

  • censoredcreampiebig titsSKMJred face girlswing nagaseSKMJ-158SKMJ158h-1324skmj00158
    • 2021-02-02
    124 min

    [ARM-949]My Cousin's Grown Into A Smoking Hot Slut？! Coating Her Lower Half In Cum While She's Still Wearing Her Panties Tsukino Okawa

  • okawa tsukino censoredsingle workARMaroma planninghamu oujiaromaARM-949ARM949arm00949
    • 2020-11-13
    116 min

    [VRTM-520]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her! 2

  • aishin shinkawa kurata mao censoredslutVRTMv r producegoro koenjiVRTM-520VRTM520h-910vrtm00520
    • 2020-11-08
    113 min

    [PARM-164]Girl Shows Her Ass To Provoke

  • akimoto chihaya yu mizuki censoredslutPARMaroma planningmoso chirarizumuPARM-164PARM164parm00164
    • 2020-10-20
    136 min

    [ARM-916]Thigh Job And Ass Job Over Underwear - Boys Wear Briefs Too, So Contact Area Can Be Seen Well! Part. 4

  • alice toyonaka hebei haruna censoredslutARMaroma planninghamu oujiaromaARM-916ARM916arm00916
    • 2020-08-02
    125 min

    [ARM-893]Big Ass Panty Shot Cosplay - I Want Them To Play With My Cock

  • rina ayana akari nanara haruka takami censoredcosplayslutARMaroma planningkijin kasaiaromaARM-893ARM893arm00893
    • 2020-07-24
    150 min

    [MIDE-806]When Our Parents Aren't Looking, She's Luring Me To Panty Shot Temptation! This Tsundere Little Stepsister Enjoys Teasing Her Lolita-Obsessed Big Stepbrother!! Yui Shirasaka

  • yui shirasaka censoredschoolgirlsisterMIDEmoodyzgoemonmoodyz divaMIDE-806MIDE806mide00806
    • 2020-07-02
    109 min

    [ARM-882]Service With Ass While Clothed 2

  • rina ayana akari nanara mai yahiro censoredbukkakeARMaroma planninghamu oujiaromaARM-882ARM882arm00882
    • 2020-04-28
    117 min

    [EQ-516]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 8

  • censoredcreampiebig titsEQbullittshinobu kamezufetish specialtyEQ-516EQ516h-100eq00516
    • 2020-04-20
    120 min

    [VNDS-3340]I Got Excited By A Married Woman's Visible Panty Line... - Everyone Knows Mature Women Are Sexually Frustrated, So I Guess She Wouldn't Mind If I Feel Her Up...

  • censoredcreampiemature womanVNDSstar paradiseno directornext toilet r eVNDS-3340VNDS3340h-254vnds03340
    • 2020-04-16
    179 min

    [AP-760]Mom Bike Fat Ass Married Woman Quickie Creampie!

  • censoredcreampieAPapachebarracudahhh groupAP-760AP760ap00760
    • 2020-04-04
    164 min

    [GDHH-193]"If You Squeeze It Like That I'm Going To Cum Again!" I Fucked Her Cowgirl Style Until Cum Was Overflowing From Her Pussy!

  • censoredcreampieschoolgirlGDHHgolden timegorilla butahhh groupGDHH-193GDHH193gdhh00193
    • 2020-03-13
    120 min

    [VRTM-488]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her!

  • manami oura miho tsuno censoredslutVRTMv r producegoro koenjiVRTM-488VRTM488h-910vrtm00488
    • 2020-01-16
    222 min

    [HUNTA-709]I'm Getting Knocked Out By That Tight Little Ass She's Thrusting At Me!! My Little Sister-In-Law Has A Super Beautiful Ass And A Godly Ass And I Creampie Fucked Her Over And Over Again!! I Suddenly Got A New Little Sister-In-Law, A

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-709HUNTA709hunta00709
    • 2020-01-08
    139 min

    [ARM-830]Thigh Job And Ass Job Over Underwear - Boys Wear Briefs Too, So Contact Area Can Be Seen Well! Part. 3

  • blue rion izumi censoredslutARMaroma planninghamu oujiaromaARM-830ARM830arm00830
    • 2019-12-13
    120 min

    [VRTM-468]I Peeked Under The Foot Warmer And I Saw My Stepdaughter's Panty Shot Flashing At Me! I Couldn't Resist, So When I Touched Her Still-Developing Pussy, She Started Getting Dripping Wet And Got Super Horny! Her Mother Is Sitting Right

  • scooping atomi shuri censoredcreampieuniformVRTMv r produceelza nagasakiVRTM-468VRTM468h-910vrtm00468
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-12-07
    148 min

    [MIAA-197]Tempted By My Shy-Girl Step-Daughter I Can't Hold Back When She Provokes Me By Giving Me A Full View Of Her Unprotected Panties Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-197MIAA197miaa00197
    • 2019-11-23
    152 min

    [MIAA-194]A Quickie Fuck Gal Who Gets Old Men Hard With Panty Shot Temptation

  • censoredbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-194MIAA194miaa00194
    • 2019-11-23
    119 min

    [MIAA-191]Begging Backdoor Piston Pumping Sex 2 A Horny Beautiful Young Babe In Uniform Who Will Lure You To An Erection With Panty Shot Temptation Yui Nagase

  • yui nagase censoreduniformbeautiful girlMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-191MIAA191miaa00191
    • 2019-11-08
    117 min

    [ARM-810]Uniform 25 cm Above The Knee, Panties, And A Blowjob

  • rei kitano tsukimiya koharu censoredschoolgirlblowjobARMaroma planningshigeo kadowakiaromaARM-810ARM810arm00810
    • 2019-11-08
    111 min

    [VRTM-464]"You Want To See My Panty Shot Action, Don't You？" This Neat And Clean Girl Is Tempting Me By Begging For A Quickie! She's Hiding From Her Mom And Getting Her Father-In-Law's Cock For A Cum Crazy Orgasmic Good Time! And

  • scooping hikaru minazuki censoredcreampieVRTMv r producerokutanzo no seishiVRTM-464VRTM464h-910vrtm00464
    • 2019-11-08
    108 min

    [ARM-813]I'm At Work, But This Elder Sister Type Is Luring Me To Temptation By Shoving Her Panty-Covered Pussy Into My Face

  • mihina azumihina mihina nagai umi hyuga censoredsluthandjobARMaroma planninghamu oujiaromaARM-813ARM813arm00813
    • 2019-10-20
    121 min

    [ARM-808]Slick And Slippery Lotion Lathered Twat-Emphasizing Panties And Pussy-Grinding Services

  • hikaru minazuki alice toyonaka censoredslutARMaroma planninghamu oujiaromaARM-808ARM808arm00808
    • 2019-10-20
    108 min

    [ARM-806]Miki Sunohara x Tight Miniskirt Thick Ultimate Plan

  • future sunohara censoredcosplaysingle workARMaroma planningshigeo kadowakiaromaARM-806ARM806arm00806
    • 2019-09-26
    159 min

    [SW-655]My Stepsister And Her Friends Are Devilish Little Sluts! They Came Over To My House And Lured Me To Miniskirt Panty Shot Temptation, And While My Little Stepsister Was Looking The Other Way, I Shoved My Big Orgasmic Cock Into Their Pussies An

  • censoredslutsisterSWswitchyocchanswitch switchSW-655SW6551sw00655
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV