cosplay beautiful girl def jav javcensored




FC2BBANVENXAPODSTARSABWONEZDASDROYDFSDSSCESDSHKDMVSDNATRHMNDTTSSISMIAAMIDVHDKAAUKS

2024-05-04
167 min

PRIN-014 [Doujin AV] DOJINHOLIC [Underground Idol Part -time Layer] Reverse Bunny Costumes [extremely Small Ma ● K] Skewered Vaginal Boko [small Fish Acme] Rich Saliva Drink

  • censoredamateurcosplayPRINprince zazuru delusional tribePRIN-014PRIN014prin00014
    • 2024-04-20
    320 min

    HOIZ-122 Hoi Hoi FRIENDS 09 Amateur Hoi Hoi FRIENDS, Personal Shooting, Saffle, Home, Home, Amateur, Beautiful Girls, Sister, Gonzo, Big Breasts, Big Breasts, Big Breasts, Busty, Squirting, Squirting, Cosplay, Cosplay, Documentary, Slut, Slut

  • censoredbig titsamateurHOIZamateur hoihoi delusion groupHOIZ-122HOIZ122hoiz00122
    • 2024-04-12
    140 min

    MIH-006 松本いちかと中出しSEXしたい人お気軽にDM下さい M男、早漏、絶倫男子と出会って即ハメ即パコ連続中出し！！ 松本いちか

  • ichika matsumoto censoredcreampiecosplayMIHbookthere is alsomatsumoto ichikaMIH-006MIH006mih00006
    • 2024-03-26
    121 min

    SDMUA-082 "Seniors, Are You The Same When Iku？" Sweet Saddle Cheerleader That Supports My Ejaculation With Brain Toro And Panchira Butt Fried Dance

  • yui tenma shibuya akari censoredbig titscosplaySDMUAsod createtakato kasaisodSDMUA-082SDMUA0821sdmua00082
    • 2024-03-15
    130 min

    MUKC-056 Off -paco Orgy Photo Session That Connects Neat Underground Idols With Back Business.If You Can Recommend It, Our Slut Angel Who Can Unlimited Raw Vaginal Cum Shot.Matsuoka Misakura

  • matsuoka mio censoredcreampiecosplayMUKCinnocentsolid costMUKC-056MUKC056mukc00056
    • 2024-03-15
    120 min

    MUKC-057 The Strangers Are Smiled By The Strangers.Kosupure Hot Spring Individual Shooting Trip.

  • censoredcosplaybeautiful girlMUKCinnocentsolid costMUKC-057MUKC057mukc00057
    • 2024-03-15
    170 min

    MUKC-047 Estrus Cosplay Beautiful Girls Who Are Immersed In Creampie Mating Full Clothes 8P Great Orgy

  • censoredcreampiecosplayMUKCinnocentsolid costMUKC-047MUKC047mukc00047
    • 2024-03-01
    140 min

    NOSKN-078 F Cup Amateur Concafe Miss Is A Creampie Creampie!An Amateur Cosplayer Sakura (20) Walnut Sakura (20) A 20 -year -old Tsundere Mine -based Beautiful Girl Is Crazy Due To A Middle -aged Father Of A Middle -aged Father

  • walnut sakura censoredcreampieamateurNOSKNnorthkinsNOSKN-078NOSKN0781noskn00078
    • 2024-02-24
    84 min

    CSPL-021 [4K] 4K Revolution Cheer Is Cute, But It Doesn"t Stop.Rabbit Wakui

  • wakui misato censoredcreampiebig titsCSPLcrystal picturecosdeluxe plusCSPL-021CSPL021cspl00021
    • 2024-02-17
    132 min

    NCYF-028 6P Big Orgy SEX Really Former Child Actor Talent Beautiful Girl Layer 18 Years Old Correcting The Personality Of A Cocky Female Brat [Crazy Bottomless Orgasm Torture] [Everyone Semen Pregnancy Experiment] [Infinite Loop Of Creampie On The Ve

  • censoredcreampiecosplayNCYFall japan kameko cooperative delusional groupudagawaall japan kameko cooperative mousouzokuNCYF-028NCYF028ncyf00028
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-10
    240 min

    SABA-882 Cute As A Celebrity! Become Friends With A Beautiful Girl And Do A Follow-up Investigation! Assortment Of Cute SEX! A Huge Resemblance To The National Idol! Facial Deviation Value Exceeds 70! She Has A Great Personality And Loves Naughty Thi

  • censoredcreampieuniformSABAclass s amateurtodoSABA-882SABA882saba00882
    • 2024-02-07
    67 min

    COSX-052 M-chan, A Super Cute Layer With 48,000 Followers, Is Obsessed With Cospaco Photo Sessions With Old Men And Is Addicted To Punch Lines.

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-052COSX052cosx00052
    • 2024-01-26
    118 min

    ORECS-108 Pick Up A Female College Student With Outstanding Model-class Style! She Is Wearing A Bunny Girl Outfit, Exposing Her Sexy Legs And Cleavage, And Swaying Her Ass As She Boldly Serves You! "I Feel It More Than Usual...//" The JD Bunn

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-108ORECS108h-1732orecs00108
    • 2024-01-24
    69 min

    COSX-051 We Invited M-chan, A Super Cute Layer With 48,000 Followers, To Participate In An Erotic Spaco Photo Session.

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-051COSX051cosx00051
    • 2023-12-21
    73 min

    AEGE-020 Complete Obedience Plan For A Charismatic Beauty Layer That Is Popular Among Couples! Kana Morisawa

  • kanako ioka censoredcosplaybeautiful girlAEGEaegeanAEGE-020AEGE020
    • 2023-10-25
    265 min

    SPRO-089 Halloween Gal Pick-Up In Shibuya 3 Cosplay Beauties In The City Are Too Erotic! ! Drink And Get Drunk And Get A Man Immediately! 4 People

  • censoredamateurcosplaySPROamateur proSPRO-089SPRO089h-1594spro00089
    • 2023-10-15
    291 min

    AT-171 Undiluted J-type Salt Compatible Cosplayer Creampie Off Paco Workman

  • censoredcreampieschoolgirlATlotusAT-171AT171h-047at00171
    • 2023-08-29
    72 min

    EROFV-198 Amateur Female College Student [Limited] Nonoka-chan, 21 Years Old. ! Massive Vaginal Cum Shot SEX While Enjoying The Soft Body That You Can Not Usually Taste! !

  • censoredcreampieuniformEROFVhamedori.network secondeditionlove girlfriendEROFV-198EROFV198h-1472erofv00198
    • 2023-07-08
    211 min

    TNOZ-025 Gachi 5P Large Orgies Big Boobs Big Breasts Wheel 100cm Layer 18 Years Old [Nipple Iki Repeated Super Sensitive & Throat Irama Ezuki Juice Massive Injection] Climax Pee Public De M White Drodo...

  • censoredbig titscosplayTNOZall japan kameko cooperative delusional groupsecond generation brim drinking uncleTNOZ-025TNOZ025tnoz00025
    • 2023-07-08
    142 min

    WORL-001 The World"s Common Body Language A Beautiful Girl Who Got It From A Dating Site Is A Cosplay Creampie Serious AV Appearance

  • liz ocea censoredcreampieWORLavs collector savs collector s worldWORL-001WORL001worl00001
    • 2023-06-24
    240 min

    OKAX-909 Naughty Service Only For Your Master! ! Welcome Back, Master! How About Masturbating Without Me？

  • aoi strawberry hinako mori censoredcosplaybeautiful girlOKAXkm produceside dishesOKAX-909OKAX909okax00909
    • 2023-06-08
    171 min

    MIST-403 Slut With Beautiful Legs Knee High Boots And Pantyhose Narumi Hirose

  • narumi hirose censoredbig titscosplayMISTmr michirucherry and miyamaMIST-403MIST4031mist00403
    • 2023-05-25
    70 min

    KAMEF-033 Individual Shooting Specialized Campaign Girl Photo Session Narumi-chan (20) Machida Lens"s BLACK KAMEKO FILE.33 Weekly Magazines Featuring Many Corporate Projects Gravure Squirting Individual Shooting A Natural Nasty Model Who Is Shaki

  • censoredcreampiesquirtingKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-033KAMEF033h-1350kamef00033
    • 2023-05-24
    69 min

    COSX-039 Minori-chan, An Amateur Layer Who Is Motivated Enough To Wear A Trendy Cosplay Costume, And A Raw Squirrel Personal Photo Session Of A Full-fledged Uncle. Rarely Hit A Cute Demon Girl With An Uncle"s Raw Stick. WW

  • censoredcreampiesquirtingCOSXuncle pacohame taking uncleCOSX-039COSX039cosx00039
    • 2023-05-24
    68 min

    COSX-041 [Power] Tension MAX Big Breasts Layer Mitsuki-chan In Chan Cosplay. I Tried Forcing Creampie SEX At A Photo Session Just The Two Of Us! "Mitsuki-chan, The Devil Doesn"t Wear A Bra, Doesn"t Even Wear A Condom, And Doesn"t Use

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-041COSX041cosx00041
    • 2023-05-18
    121 min

    FANH-143 Tall Model Almost Virgin JD Aoba-chan 19 Years Old Slender Ma Wearing A Vibrator On A Co.

  • censoredcreampieamateurFANHhamedori.network secondeditionFANH-143FANH143h-1472fanh00143
    • 2023-04-28
    300 min

    DVDMS-950 Anal Sniffed And Licked At Photo Session The Smell Of Her Ass Hole Pussy/She Was So Embarrassed That She Was Horny... A Greedy Erotic Beautiful Girl Alternately Asking For Anal Cunnilingus And Bareback Cock Inserted During Sex With Her Ass

  • kozue fujita kashiwagi konatsu censoredcreampiecosplayDVDMSdeepsmotofuji peroflavors flavorsDVDMS-950DVDMS950dvdms00950
    • 2023-04-22
    127 min

    NCYF-023 Gachi 7P Super Orgy [Continuous Insertion Of Huge Cocks In Minimal Crack] 141cm Minimum Fairy Beautiful Girl Layer Shaved Innocent Body Raw Saddle Vaginal Cum Shot Trampled [Reason Collapse De M Awakening] Idol Beauty Collapses Incontinence

  • amateur censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversNCYF-023NCYF023ncyf00023
    • 2023-04-21
    117 min

    HMN-327 Former Tag A Dancing Girl Who Likes To Sell Beer At A Dome, She"s A Dancing Girl And Gets Her First Raw Creampie Rika Yumeri

  • yumeri rika censoredcreampiecosplayHMNhon nakaHMN-327HMN327hmn00327
    • 2023-04-15
    154 min

    TNOZ-022 Serious Voice Actor Idol Aspiring Beautiful Girl Layer 18 Years Old Unbelievable Intrinsic De M Nature [Drinking Saliva & Irama Throat Ejaculation Cum Swallowing] [Iki Leaving Incontinence Peeing & Raw Vaginal Cum Shot] Beautiful Girl Soaked

  • amateur censoredcosplayTNOZall japan amateur photographers union daydream fantasy loversTNOZ-022TNOZ022tnoz00022
    • 2023-04-14
    148 min

    MUKC-036 Another World Girl Confinement Research Record Mei Mitsuki

  • mei mitsuki censoredcreampiecosplayMUKCmukuMUKC-036MUKC036
    • 2023-04-14
    117 min

    HMN-370 Everyday I"m Ejaculating With Boobs And Creampie SEX From A Busty Student Who Became My Housekeeper. Walnut Sakura

  • walnut sakura censoredcreampiebig titsHMNhon nakaHMN-370HMN370hmn00370
    • 2023-03-07
    99 min

    REGOD-121 [AI Remastered Version] Rumored Brothel Building No. 3 Nao.

  • amateur censoredschoolgirlcosplayREGODwaap entertainmentREGOD-121REGOD121
    • 2023-04-13
    124 min

    FANH-133 Aspiring Model Dance Club Madoka-Chan 18 Year Old Homecoming From School Drama She Teaches A Young Pussy With A Super Thick Adult Dick, Live Vaginal Masturbation Pov

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-133FANH133h-1472fanh00133
    • 2023-04-01
    131 min

    HR-008 Chin Chin Nupu Nupu ◆ Melody Hina Marks (22) [Angel Covered In Oil] I'M Sorry For Being A Horny Woman Who Looks Like An Erotic Manga [True Vaginal Cum Shot] “Did You Insert It During A Massage? It'S A Reverse Bunny For Punishment ♪”

  • melody mark censoredcreampiecosplayHRplumhimrockamateur only plumHR-008HR008h-113hr00008
    • 2023-03-30
    160 min

    KAMEF-029 Cosplay Photo Session Mirei Specializing In Individual Shoots Mirei (25) Machida Lens'S Black Kameko File.29 Superb Style Gravure Idol Makes A Bunch Of Oho Voices Completely Rubberless At A Private Photo Session, Pov Orgy Orgy With Duckling

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-029KAMEF029h-1350kamef00029
    • 2023-03-25
    273 min

    HERK-006 Hoihoi Erokyun 6 Amateur Hoihoi Erokyun Personal Shooting/Matching App/Pov/Amateur/Sns/Backside Act/Neat/Facial/Slender/Cosplay/Electric Massage/Beautiful Girl

  • censoredamateurcosplayHERKamateur hoihoi delusion groupHERK-006HERK006herk00006
    • 2023-03-02
    86 min

    KAMEF-027 Solo Shoot Specialized Cosplay Photo Session Rentan Machida Lens'S Black Kameko File.27 Personal Shoot With The Greatest Beautiful Girl Private Connection With The Greatest Beautiful Girl Off Paco And No Rubber Raw Pov, Massive Vaginal Cum

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-027KAMEF027h-1350kamef00027



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV