god




FC2LULUAUKGCESDMILKMIDEHNDSHKDCHRVADNSSNIMEYDFSDSSPREDDTTIPXPPPDONEZMIDVSDABBLK

2023-01-13
61 min

529STCV-217 God Slim High Class Gal Is The Daughter Of Antisocial Forces! ？ A Desperate Hush-Up For A Super-Yaba Project! Rub The Marshmallow Breasts! The Reaction Is Too Good And I Cry Out With A Cute Voice! Electric Massager Blame That The Ultimate

  • amateur censoredcreampieamateurstcvstcv-217stcv217529stcv-217
    • 2023-01-06
    39 min

    FC2PPV 3161981 [Uncensored] [H Cup] Female College Student With Natural Big Breasts. Devour The Young And Healthy God Body And Chewy Huge Breasts To The Bone Marrow! Take Away The Right To Refuse Vaginal Cum Shot And Put Out A Large Amount Of Demon P

  • amateur uncensored
    • 2023-01-01
    44 min

    FC2PPV 3149494 Real Body Measurements For Her Reiwa Strongest Milk Girl Shaking Her H Cup Slime Milk A Huge Amount Of Vaginal Cum Shot With Raw Insertion On The Verge Of An Accidental Explosion With God’s Pie Zapping There Is A Review Privilege

  • amateur uncensored
    • 2022-12-30
    45 min

    FC2PPV 3157256 God Body First Shooting! A Transcendentally Beautiful Hostess Is A Graduate Of A Certain National Public University [Appearance] Unsatisfied With Premature Ejaculation Man, She Is Unsatisfied With Her Constriction And Ideal Breasts, An

  • amateur uncensored
    • 2022-12-27
    58 min

    FC2PPV 3154756 ※Limited First Time ※[Minato Ward Project] God Style Erotic Kawa Reading Model Rina 26 Years Old Gonzo Creampie At A Luxury Hotel In Broad Daylight × 2 [cen]

  • amateur uncensored
    • 2022-12-27
    66 min

    FC2PPV 3154094 [Appearance] [Cumshot Twice] Outflow Strictly Prohibited! Super Beautiful ♡ Gonzo With Former Big Breasts Gravure! Raw Gonzo Creampie Twice That Makes The Japanese God Kubire & Glamorous Body Brun Brun! [cen]

  • amateur uncensored
    • 2022-12-24
    27 min

    FC2PPV 3152934 [God’s Ejaculation] Cum Swallowing 5 Consecutive Cum Swallowing Sperm Accumulated For 5 Days Or More Cum Swallowing Off Meeting #15

  • amateur uncensoredbukkake
    • 2022-12-22
    209 min

    FC2PPV 3149740 Goddess! ! , God Face + God Style! ! , F Cup Beauty Big Breasts! ! , Thinking Of A Lovey-Dovey Boyfriend, "I Want To Go Home …" "After All, I Want Pocket Money" Conflicts Of A Female College Student …, Gave M

  • amateur uncensored
    • 2022-12-31
    138 min

    PKPD-226 Completely Private Footage Original Gravure God Body E Cup Tall Beauty A Sleepover Alone With Miyu Inamori

  • miyu inamori censoredPKPDpakopako team and pleasant friends delusion groupPKPD-226PKPD226pkpd00226
    • 2022-12-30
    160 min

    MIDV-249 Ban Unbanned G-Cup God Slender Yo●Tu●E● First Vaginal Sex In Her Life In Front Of The Camera Asumi Mirai

  • tomorrow s future censoredcreampiesingle workMIDVmoodyzkyouseimoodyz divaMIDV-249MIDV249midv00249
    • 2022-12-28
    210 min

    GODR-1096 The Morning I Greeted My Female Boss In The Wrong Shared Room During A Business Trip... She Was Beautiful In Her Defenseless Bra And Shirt...

  • censoredcreampieGODRtriple hhasshigodGODR-1096GODR109678godr01096
    • 2022-12-27
    87 min

    435MFCS-050 [Dedication Of Raw Dick & Semen To The Sexual Mako Of A Shrine Maiden Who Serves God ♪] Adhesive Coverage In The Name Of A Magazine Project → The More You Know, The More You Get Along With Your Mind And Body Icharab Development! ! Seri

  • amateur censoredcreampieamateurmfcsmfcs-050mfcs050435mfcs-050
    • 2022-12-26
    76 min

    259LUXU-1617 Luxury TV 1642 No Dating People! ？ But More Than 50 Experienced People! ？ Idol-class God Face Beauty! A Slender Sensitive Body That Jumps Up Again And Again!

  • amateur censoredamateurluxuluxu-1617luxu1617259luxu-1617
    • 2022-12-24
    116 min

    390JAC-152 [2 Holes X Explosive Tide! ! Unstoppable Anal Love… God Of Shock Iki Flying Gal] High Tension F Milk Gal Nachosu Attack! ! A Super-Perverted Talent Who Is Completely Covered In Sex In The Brain! Haste, Explosive Tides! ! Haste, Anal I

  • amateur censoredcreampiebig titsjacjac-152jac152390jac-152
    • 2022-12-24
    256 min

    FC2PPV 3152738 God Advent! ! , Transcendental Beauty 20 Years Old! "Complete Appearance" Outstanding Neck Line From The Bowl-Shaped Breasts Of The E Cup. "Transcendence Beauty + Outstanding Style" Highest Peak Confirmed "8K VR Vid

  • amateur uncensored
    • 2022-12-23
    120 min

    OAE-228 Naked God Kawakita Ayaka

  • ayaka hebei censoredsingle workOAEair controlpaul doddOAE-228OAE228oae00228
    • 2022-12-22
    51 min

    229SCUTE-1282 Ami (25) S-Cute God Style Beauty Is Disturbed H

  • amateur censoredbig titsamateurscutescute-1282scute1282229scute-1282
    • 2022-12-21
    98 min

    420HHL-018 N.O (21) Amateur Hoihoi Lover/Amateur/Beautiful Girl/Big Tits/Cosplay/Constriction/Couple/Facial Cum Shot/God Breasts/2 Shots/Masturbation/Apparel/POV

  • amateur censoredbig titssquirtinghhlhhl-018hhl018420hhl-018
    • 2022-12-20
    480 min

    TRE-190 Amateur TV × PRESTIGE Super Sensitive Musume God Times BEST Vol.04 A Beautiful Girl With A Super Sensitive Constitution Who Gets Wet Just By Touching It Boldly Disturbs!

  • amateur censoredamateurtretre-190tre190tre-190
    • 2022-12-20
    53 min

    FC2PPV 3148424 World Cup Thank You God Class Lucky Bag!

  • amateur uncensored
    • 2022-12-17
    46 min

    FC2PPV 3146764 Body 100 Points College Student (Bowl-Shaped Big Breasts, God Constriction, Nice Bottom) 20-Year-Old And Gonzo Who Erects In An Instant When The Clothes Are Plain [cen]

  • amateur uncensored
    • 2022-12-18
    109 min

    563PPZ-015 [God Milk! J Cup Tutor] The Deviation Value Of The Student Becomes Zero, The Tutor Who Is Too Busty! "Wow, My Dick Is Getting Hard？ What Do You Want？ Huh, Do You Want Me To Pinch It？ You Like My Boobs So Much W" [Pai Pai Zuriko. ]

  • amateur censoredbig titsamateurppzppz-015ppz015563ppz-015
    • 2022-12-18
    115 min

    083PPP-2612 30 Explosive Beauty Covered With Oil! Sensual Masseuse God Hand Mikami"s Transcendence Technique

  • amateur censoredamateurpppppp-2612ppp2612083ppp-2612
    • 2022-12-17
    99 min

    KTKC-156 Oh My God, I'M Too Weak To Push. Satanic Rocket Milk No Shiro And Daughter (Real Name Not Disclosed).

  • censoredcreampieamateurKTKCkichikkusu mousou zokukyonyuuKTKC-156KTKC156ktkc00156
    • 2022-12-15
    483 min

    MTABS-002 Big Breasts 8 Hour Best Chosen By Shocking God Of Biggest Mcup

  • ruri saijo riho fujimori censoredMTABSmateriallMTABS-002MTABS0021mtabs00002
    • 2022-12-15
    160 min

    FC2PPV 3145336 [Uncensored] Super Soft Body! Fair-Skinned Snowy Skin And F-Cup Marshmallow Boobs ♡ The Best Meat Onaho Gift From God At The End Of 2022! I’m Going To Use A Soft Masturbator With A Double Cum Shot Of Thanks To God!

  • amateur uncensored
    • 2022-12-14
    76 min

    435MFC-224 Supreme God Pai Beautiful Body Mei Teacher "Tall Deca Milk Saffle Who Broke Up In Tokyo And Memories Revived Raw Paco Cum Shot ♪" Yukata Dating At A Nostalgic Festival With A Broken Saffle Who Came Back Home After Being Cheated / A

  • amateur censoredcreampiebig titsmfcmfc-224mfc224435mfc-224
    • 2022-12-14
    106 min

    300NTK-806 [God Style OL Each Defeated! ! Instant Protein! ! Instant H Special Edition] [Slender Orthodox Beauty Bitch"s Full Paisen & Gal Beauty Junior OL Bitch"s Beautiful Breasts] [Both Are Discovered To Be Shaved Miracle Hairless Generati

  • olololsp censoredcreampieamateurntkntk-806ntk806300ntk-806
    • 2022-12-13
    103 min

    ARMS-002 Paiotsu Hard-Boiled 001 / Cream Pie God Milk / Strongest Style Big Tits / Yawayawa Colossal Tits

  • amateur censoredcreampiebig titsarmsarms-002arms002arms-002
    • 2022-12-13
    45 min

    FC2PPV 3144301 [No] Super Sensitive To God’S Style ☆ A Beautiful Older Sister Who Sells Cosmetics Has A Thick Vaginal Cum Shot Seeding Press

  • amateur uncensored
    • 2022-12-03
    118 min

    AUKG-554 Overnight Lesbian ~Travel Destination, Late Bloomer, Drunken~

  • yuki god mikako horiuchi censoredAUKGu amp kAUKG-554AUKG554aukg00554
    • 2022-12-02
    68 min

    FC2PPV 3138440 [Individual Shooting / J Series] <Super Ubutsu Daughter Rocket Milk> [God Milk Advent] I’m Shy, Quiet, And I Haven’t Even Grown My Hair Yet, But I Made A Very Sensitive Pussy Into An Old Man’s Sex Processing Toy!

  • amateur uncensored
    • 2022-12-02
    69 min

    STCV-206 God Soooo Beautiful Big Breasts X Bottomless Demon Sexual Desire!! My Hobby Is Sex! A Super Beautiful Woman Whose Daily Routine Is To Drink And Do It Has Appeared! Strongest Dirty Technique Ji Po & 3 Nipple Blame! Super Lively Barrage Agains

  • censoredSTCVamateur cloverSTCV-206STCV206h-1616stcv00206
    • 2022-11-30
    77 min

    OCH-011 Train Idiot ● Selection11

  • censoredOCHgod timesOCH-011OCH011h-1580och00011
    • 2022-11-29
    56 min

    FC2PPV 3136759 [Uncensored] [Face Exposure] Platinum Amateur Girl With God Milk F Cup. Counseling To A Beautiful Woman Who Can’t Expose Her Frustration With Her Boyfriend’s High Pride And Development Sex. "Sorry About My Boyfriend~ I

  • amateur uncensored
    • 2022-11-29
    67 min

    FC2PPV 3136602 [Decision To Leak Out For The First Time In P Life] Cute Baby Face └|Twin Tail Idol Class Face, God Slender Beautiful Breasts Nice Butt Beautiful Legs It’s Ok If You Negotiate To Shoot, But It’s A Bitch I’ve Seen, So I P

  • amateur uncensored
    • 2022-11-26
    15 min

    FC2PPV 3135663 [God Time Decision] [I Got Yarra In Front Of My Sister…] My Sister Gives A Blowjob In Front Of Her Sister And Ends Up Getting Yarra Www [cen]

  • amateur uncensored
    • 2022-11-25
    44 min

    FC2PPV 3135227 [Uncensored] God’s Hand! Super-Tech Ejaculation Management Of S-Class Men’s Beauty

  • amateur uncensored
    • 2022-11-23
    95 min

    UNDG-002 [Tide God Advent...!!] Demon Sexual Desire Gal Vs. Demon Ji ● Pomecha Shikovic Squirting Rolls Up A Total Volume Of 4 Liters!! Bed Submerged Camera Destruction Vaginal Cum Shot Gangimari Gonzo!!

  • censoredcreampiesquirtingUNDGshin passumo falenotubeUNDG-002UNDG0021undg00002
    • 2022-11-21
    71 min

    546EROFC-118 [God Slender] Piano Major, Music Student Coming To Tokyo Girl. While Being Serious And Obedient, I Can"t Suppress My Interest In The Cock, And The Nasty Gonzo Outflow! An Upperclass Family Lady"s Depressed Libido Is Exposed [Gari

  • amateur censoredcreampieamateurerofcerofc-118erofc118546erofc-118



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV