jav censored def beautiful girl javcensored




FC2JUFEVENUROYDCHRVMIDEAUKSWANZCESDCJODSSISMARAAVSAAUKGFSDSSVEMACAWDNATRMILKPREDMVSD

2024-02-16
120 min

MIDV-611 Power Outage Door Lock Confinement, Estrus Sexual Harassment At A Convenience Store In The Middle Of The Night, Store Manager"s Runaway Sex, Slow And Slow Piston Frantic Acme, Rena Miyashita

  • miyashita rena censoredschoolgirlblowjobMIDVmoody scaptain gangwonmoodyz divaMIDV-611MIDV611midv00611
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-10
    240 min

    SABA-882 Cute As A Celebrity! Become Friends With A Beautiful Girl And Do A Follow-up Investigation! Assortment Of Cute SEX! A Huge Resemblance To The National Idol! Facial Deviation Value Exceeds 70! She Has A Great Personality And Loves Naughty Thi

  • censoredcreampieuniformSABAclass s amateurtodoSABA-882SABA882saba00882
    • 2024-02-10
    240 min

    BAZX-389 After School, Uniform Girl Will Be Delivered To You. 01 Would You Like To Play Aoharu With Me？

  • censoredcreampieuniformBAZXbazookatodoBAZX-389BAZX389bazx00389
    • 2024-02-10
    244 min

    KTRA-611 Kate Live Uniform Beautiful Girl Encyclopedia 4 Hours

  • inaba hanaoto urara censoreduniformschoolgirlKTRAk tribeKTRA-611KTRA611ktra00611
    • 2024-02-10
    120 min

    BAZX-391 Thoroughly Verified Real Documentary Show AV Shooting Serious Pick-up Party Drinking Party With Models After Shooting! Get Me Drunk And Seduce Me! 02

  • censoredcreampiebeautiful girlBAZXbazookatodoBAZX-391BAZX391bazx00391
    • 2024-02-07
    67 min

    COSX-052 M-chan, A Super Cute Layer With 48,000 Followers, Is Obsessed With Cospaco Photo Sessions With Old Men And Is Addicted To Punch Lines.

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-052COSX052cosx00052
    • 2024-02-07
    79 min

    ETQR-516 Cuddling Sex With A Girl Who Loves You Tsukino Okawa

  • censoredcreampieblowjobETQRerotic timeETQR-516ETQR516etqr00516
    • 2024-02-07
    82 min

    ETQR-515 Cuddling Sex With A Girl Who Loves You Ako Momona

  • censoredcreampieblowjobETQRerotic timeETQR-515ETQR515etqr00515
    • 2024-02-05
    56 min

    NHDTB-90502 Even If She Runs Away, A Sensitive Female College Student Succumbs To The Continuous Fingering From Behind, Making Her Squirt 2. Beautiful Black-haired Girl

  • censoredsquirtingNHDTBnatural highsymmetry nakatanatufileNHDTB-90502NHDTB905021nhdtb90502
    • 2024-02-02
    150 min

    BKYNB-043 My First ASMR Job With A Close Colleague Was A Super Slut Who Made My Brain Cum With Dirty Talk Even Though I Was Lethargic And Relaxed.

  • suehiro ju censoredcreampiebeautiful girlBKYNBbon kyun bonBKYNB-043BKYNB0431bkynb00043
    • 2024-02-02
    240 min

    NKM-005 Beautiful Body That You Want To Insert Every Day 4 Super Lewd Beauty SPECIAL 10 People 4 Hours

  • censoredcreampiebig titsNKMthis is it laymanNKM-005NKM005h-1631nkm00005
    • 2024-01-30
    150 min

    KKBT-004 High Grade Delivery Health [Club Brenda VIP TOKYO] Active Adult Entertainment Cast Nozomi Ichijo Her Pretty Body Trembles Lewdly And She Gets Intoxicated By A Big Dick.

  • ichijou nozomi censoredblowjobbeautiful girlKKBTsod createirori ranchnationwide sex shop cooperation av cast that can be played tomorrowKKBT-004KKBT0041kkbt00004
    • 2024-01-30
    261 min

    SPRO-095 Creampie Amateur POV Hot Spring Date Female College Student/Underground Idol/Gal X 2

  • censoredcreampiebig titsSPROamateur proSPRO-095SPRO095h-1594spro00095
    • 2024-01-27
    83 min

    CHC-004 Mariru-chan, 21 Years Old Mariru Narumi

  • narumi mariru censoredblowjobbeautiful girlCHCchc studioCHC-004CHC004h-1751chc00004
    • 2024-01-26
    88 min

    SBMO-1261 We Are... Of Course... Naughty, Right？ Mirai Takahashi VS Miho Wakabayashi

  • future takahashi miho wakabayashi censoredbeautiful girlSBMOsomebodymonikerSBMO-1261SBMO1261h-714sbmo01261
    • 2024-01-26
    137 min

    CAND-1221 Love Stupid Miyu Yoshikawa

  • yoshikawa miyu censoredbeautiful girlCANDteen s candyCAND-1221CAND1221h-722cand01221
    • 2024-01-26
    240 min

    IBW-942 4 Hours Of Saliva-filled Rota Blowjob From 20 People

  • amateur censoredblowjobbeautiful girlIBWnonIBW-942IBW942
    • 2024-01-26
    118 min

    ORECS-108 Pick Up A Female College Student With Outstanding Model-class Style! She Is Wearing A Bunny Girl Outfit, Exposing Her Sexy Legs And Cleavage, And Swaying Her Ass As She Boldly Serves You! "I Feel It More Than Usual...//" The JD Bunn

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-108ORECS108h-1732orecs00108
    • 2024-01-26
    26 min

    NJPD-010 Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlNJPDnew japan av actress directorynew japan av actress directoryNJPD-010NJPD010h-1754njpd00010
    • 2024-01-26
    243 min

    IBW-941 Beautiful Romantic Girl Abducted Strong Rape Video Collection 4 Hours

  • amateur censoredbeautiful girlIBWnonIBW-941IBW941
    • 2024-01-26
    149 min

    IBW-943 A Two-day, One-night Trip To Female Brats With My Favorite Teacher, Nijiiro Gumi

  • rainbow color censoredbeautiful girlIBWnonIBW-943IBW943
    • 2024-01-26
    480 min

    ATKD-362 ATTACKERS Tsumugi Akari First Rape BEST

  • akari tsumugi censoredbeautiful girlATKDattackersattackers bestATKD-362ATKD362atkd00362
    • 2024-01-25
    186 min

    NHDTB-875 When I Put An Aphrodisiac On A Girl Who Stubbornly Refused To Have Sex During A Personal Video Shoot, It Was So Strong That She Fell Down...Convulsions And Creampie 2

  • censoredcreampiesquirtingNHDTBnatural highwataru kunNHDTB-875NHDTB8751nhdtb00875
    • 2024-01-25
    129 min

    PFT-001 Mankitsuchu Original Work By Haruto Torasuke"s Popular Doujin Comic Live-action! Nozomi Arimura

  • censoredcreampiebig titsPFTfaleno tubedazai chinpoPFT-001PFT0011pft00001
    • 2024-01-25
    140 min

    KANO-018 Amateur Sex Lovey-dovey Creampie VOL.3 Rei & Niina

  • misumi rei it s in tomikunaga censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-018KANO0181kano00018
    • 2024-01-24
    69 min

    COSX-051 We Invited M-chan, A Super Cute Layer With 48,000 Followers, To Participate In An Erotic Spaco Photo Session.

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-051COSX051cosx00051
    • 2024-01-24
    37 min

    MMGH-301 Magic Mirror No.1 Tickling Endurance Championship No.1 Yuka-chan 18 Years Old

  • censoredamateurbeautiful girlMMGHsod createsaijo akiramagic mirrorMMGH-301MMGH3011mmgh00301
    • 2024-01-22
    46 min

    IENFH-21702 A Naive Girl I Met In Shinjuku Tries An "intercrural Oil Massage" With A Man Who Has Sexual Problems! I Got Horny Because My Cock Was Rubbing Slippery Against My Raw Pussy, And I Said, ``I"m Going To Put It In My Pussy Lol&quo

  • censoredcreampieamateurIENFHi energyienfhIENFH-21702IENFH217021ienfh21702
    • 2024-01-22
    45 min

    IENFH-22602 An Amateur Female College Student Becomes A Nude Drawing Model Due To A High Part-time Job! Her Pussy Is Drenched In The Shame Of Her Visual Rape, Which Is Carefully Drawn Down To The Smallest Part Of Her Pussy! It Is Inserted Raw And Cum

  • censoredcreampieamateurIENFHi energyienfhIENFH-22602IENFH226021ienfh22602
    • 2024-01-19
    123 min

    FOCS-171 A Childhood Friend I Met After A Long Time Turned To A Beautiful Girl With An Erotic, Beautiful Big Breasts Body. I Couldn"t Resist The Periscope Titjob From The Protrusion Of The Bathtub, So I Hid From My Parents And Had Sweet Lovemakin

  • miyanishi hikaru censoredbig titsblowjobFOCSabc delusion groupfocusFOCS-171FOCS171focs00171
    • 2024-01-16
    71 min

    SHSK-006 Get Raw Pussy! ! A Girl"s Serious Pseudo-love Document No.003

  • censoredcreampieblowjobSHSKthat s crazy amateur fame classSHSK-006SHSK006h-1741shsk00006
    • 2024-01-16
    67 min

    STZY-012 Treasured Footage Released Before AV Debut! A Sparkling 19 Year Old! A Girl Whose Baby-faced Big Breasts Are Too Dazzling! Nanase Aoi [Nuku With Overwhelming 4K Video! ]

  • nanase aoi censoredbig titsbeautiful girlSTZYsod createstar shootstar is onSTZY-012STZY0121stzy00012
    • 2024-01-16
    170 min

    SDJS-221 First Brush Date! Reserve A SOD Female Employee For One Day! ! A SEX Document Where I Kissed A Virgin Outside And Had A Lot Of Lovey-dovey Love From Morning Till Night! ! ! Haru Shibasaki

  • shibasaki haru censoredcreampiebeautiful girlSDJSsod createyazawa receivesod female employeeSDJS-221SDJS2211sdjs00221
    • 2024-01-13
    112 min

    SQTE-519 Everyone Loves The Little Devil. Good Face, Good Mood, Good Sensitivity! Hibino Uta

  • kyono uta censoredcreampieblowjobSQTEs cuteSQTE-519SQTE519sqte00519
    • 2024-01-13
    120 min

    SUJI-218 A Shaved Pussy Yume Is Taken Away And Raped By A Neighbor"s Uncle, A New Father, And A Tall Man She Doesn"t Know.

  • censoredcreampieschoolgirlSUJIrogue mousouzokuadultererSUJI-218SUJI218suji00218
    • 2024-01-12
    120 min

    MUDR-247 Hot Spring Trip Kanon Kanane, The Daughter Of The Neighborhood Association Who Is Continuously Raped By Ugly Old Men"s Sweaty Sex Pistons And Is Forced To Climax

  • kanon kano censoredcreampiesquirtingMUDRinnocentMUDR-247MUDR247mudr00247
    • 2024-01-12
    142 min

    ORECS-095 7P Big Orgy In Open Air Bath & 6 Beautiful Girls In Uniform Harem SEX With Full Body Licking

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-095ORECS095h-1732orecs00095



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV