mature woman tall javcensored voyeur censored




FC2BBANMIAAJULCAWDSDABCHRVAUKGVEMAHMNVENUJUFEAUKGFSDSSMILKSQTEWAAASHKDPREDWANZRBD

2020-10-16
112 min

[MXGS-1155]Erina Oka Is Like An Innocent Little Stepsister And I'm About To Fuck Her With Quickie Sex

  • hill erina censoredbeautiful girlsisterMXGSmaxingkeiha nobuyoMXGS-1155MXGS1155h-068mxgs01155
    • 2020-10-17
    64 min

    H0930 ki201018 Aoi Katayama 26years old

  • amateur uncensoredh0930
    • 2020-10-24
    44 min

    FC2PPV 1545482 [Personal shooting] No.021 Licca-chan ★ A female college student with a cute innocent look. A pretty smile and a slender body are a must-see ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2020-11-07
    52 min

    210AKO-406 AOI

  • amateur censoreduniformschoolgirlakoako-406ako406210ako-406
    • 2020-11-12
    124 min

    [FSDSS-124]A Perverted Female Teacher Who Loves D***king Sperm - Special D***king Class Ayaka Tomoda

  • ayaka tomoda censoredblowjobsingle workFSDSSfalenomusetafaleno starFSDSS-124FSDSS1241fsdss00124
    • 2020-11-13
    238 min

    [ABW-025]She'll Really Fuck You？ Nightclub Hostesses Willing To Go All The Way 17 - Enjoy The Tallest F-Cup In Porn History! An Mitsumi

  • an mitsumi censoredanalbig titsABWprestigemasarupansaabsolutely wonderfulABW-025ABW025118abw00025
    • 2020-11-21
    32 min

    FC2PPV 1578724 Limited to consecutive holidays [Individual] Mother of three children with tall beautiful legs, late repayment Visit to the new address …

  • amateur uncensoredfc2
    • 2020-12-03
    99 min

    AVKH-187 Ohara Wakana

  • amateur censoredanalamateuravkhavkh-187avkh187avkh-187
    • 2020-12-15
    64 min

    FC2PPV 1598673 [Yariman Hakata Musume] Airi [Individual shooting] I called Hakata Musume who had returned to her hometown in Corona ♪ Immediately in the car, a god-class handjob and a super sucking blowjob explode! Bring it home and poke it and shoot

  • amateur uncensoredfc2
    • 2020-12-23
    71 min

    435MFC-065 * Amateur Icharab Gonzo * Extremely hot development that is tempted by a nursery teacher with supreme erotic cuteness! The best saffle and raw SEX that accepts all worries and semen! !!

  • amateur censoredamateurbeautiful girlmfcmfc-065mfc065435mfc-065
    • 2020-12-25
    289 min

    [NASH-429]Slut Attack - This Mature Woman Is So Horny That She Gets Excited Just Looking At Young Guys, Then Sits On Their Faces And Seduces Them 3

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-429NASH429h-067nash00429
    • 2020-12-26
    123 min

    [JKSR-474]10 A.M., What's Up With The School... Erina - Erina Oka

  • hill erina censoredcreampieschoolgirlJKSRbig morkalobockeyprink junkyJKSR-474JKSR47457jksr00474
    • 2020-12-27
    136 min

    [KTKL-092]"Does This 'O-Face' Bitch Look 'Crazy'？" Nozomi Is A Neat, Clean S*****t With Tiny Tits, And She's Seriously Fierce!

  • censoredcreampiebeautiful girlKTKLkitixx mousouzokuloliconKTKL-092KTKL092ktkl00092
    • 2020-12-31
    121 min

    [NDRA-083]My Wife Became A Whore For My Neighbor 32 Ayumi Kimito

  • kimi and ayumi censoredmature womansingle workNDRAjet eizomanji groupNDRA-083NDRA083ndra00083
    • 2021-01-07
    17 min

    FC2PPV 1635625 1800pt → 900pt [Gonzo] A married woman in an affair blames M man who is a thick stranger stick and makes it splash

  • amateur uncensoredfc2
    • 2021-01-10
    71 min

    FC2PPV 1640047 ★ First shot amateur ☆ Sensitive squirting daughter Hinata of glasses Lori 21 years old ☆ Prickets best ♥ Shaved pussy electric blame mass squirting ♥ Agony in rich blowjob ♥ Gonzo raw Saddle lust cum shot SEX ♥ [Personal shooting] * W

  • amateur uncensoredfc2
    • 2021-01-11
    95 min

    300MIUM-669 Let the Momojiri nurse skip work and go sightseeing in Enoshima! Beautiful girl all the time! I want to be her! !! I want to conceive it! !! !! Instinctively cute and sly www that appeals to male DNA, so plenty of vaginal cum shot! !! !!

  • amateur censoredcreampiesquirtingmiummium-669mium669300mium-669
    • 2021-01-15
    45 min

    [srcn-062]ゆうか(24)

  • amateur censoredcreampieamateursrcnsrcn-062srcn062srcn-062
    • 2021-01-23
    239 min

    [MCSR-425]Sudden Surreptitious Finger-Banging! 2 - Knowingly Or Not, Two MILFs Go To A Pick-Up Bar For Liquor And Ended Up Getting Fucked 6 Pairs, 12 Mature Girls, 4 Hours

  • censoredmature womanMCSRbig morkalfinger banging naughty taromascottMCSR-425MCSR42557mcsr00425
    • 2021-01-29
    51 min

    495MOJ-001 Risa

  • amateur censoredcreampieamateurmojmoj-001moj001495moj-001
    • 2021-01-29
    309 min

    [XRW-969]Breaking In A Married Woman With S&M Creampie Sex 5 Hours

  • momose runa ryu enami ryu censoredbdsmXRWreal workssuginokireal real worksXRW-969XRW969172xrw00969
    • 2021-03-12
    63 min

    [orec-717]すずちゃん 2

  • amateur censoredcreampieuniformorecorec-717orec717orec-717
    • 2021-03-13
    300 min

    [DVAJ-506]I Creampied My Wife Who Is Obsessed With Her Lover And Hates Me Several Times [Cuckold Revenge] BEST

  • kawakami nanami ai mukai censoredcreampieDVAJalice japansagi kandaDVAJ-506DVAJ506dvaj00506
    • 2021-03-16
    35 min

    481SACZ-016 Risa 3

  • amateur censoredamateurbdsmsaczsacz-016sacz016481sacz-016
    • 2021-04-06
    46 min

    H4610 ki210406 Azusa Kanda 19years old

  • amateur uncensoredh4610
    • 2021-04-15
    51 min

    [fc2-ppv 1771613]【個人撮影】未踏峰!難易度S級極上ギャルとハメ撮り

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    119 min

    [JUL-563]Adulterous Trip Disguised As A Business Trip Yuna Kitano

  • yuna kitano censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-563JUL563jul00563
    • 2021-05-07
    120 min

    [FSDSS-219]Reproductive Bodies Lusting After Each Other Instinctual Sex Complete Unedited Recording Momo Honda

  • honda peach censoredsquirtinglingerieFSDSSfalenokei isoifaleno starFSDSS-219FSDSS2191fsdss00219
    • 2021-06-03
    91 min

    [IQQQ-024]Married Female Teacher Gets 10 Times As Wet As Normal During Orgasm Class Where She Can't Make A Peep Mio Kimijima

  • kimishima mio censoredcreampiemarried womanIQQQcenter villageshibuyazora center villageIQQQ-024IQQQ024h-086iqqq00024
    • 2021-06-17
    120 min

    [AQSH-071]Instructor With Huge Tits In Tight Transparent Clothing Divorced Woman Runs A Slutty Fitness Center Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsAQSHaquamall heroaquamallAQSH-071AQSH071aqsh00071
    • 2021-06-27
    65 min

    SIRO-4498 [First shot] [Massive squirting] [Tears-eyed blowjob] A 20-year-old literary girl who feels in words. She whispers her dirty words and politely treats her cock, and while being blamed for words, if she is pierced to the back of her, she spo

  • amateur censoredsquirtingamateursirosiro-4498siro4498siro-4498
    • 2021-07-14
    120 min

    [GVH-266]Step-Daughter Aiming For Mother-In-Law's Huge Tits Rinne Touka

  • roaring sound censoredcreampiebig titsGVHglory questkisakura kabinGVH-266GVH26613gvh00266
    • 2021-07-17
    153 min

    [CAWD-249]Modest And Quiet, But I Love Sex ... Natsu Hinata's Extreme Coming x 2! 3 Penetrations

  • natsu hinata censoredsquirtingbeautiful girlCAWDkawaiimichiru arashiyamCAWD-249CAWD249cawd00249
    • 2021-07-17
    153 min

    [SSIS-163]Premium Edition With Unpublished Footage! Mixed Body Fluids, Deep Sex, Full No-cut Special, Saika Kawakita

  • ayaka hebei censoredbig titsbeautiful girlSSISs1 no 1 stylemon cSSIS-163SSIS163ssis00163
    • 2021-07-18
    239 min

    [OKAX-757]A Beautiful Mature Woman With A Private Massage Room Is Sexy And Horny For Her Age! Can You Fuck Her Free Of Charge？ 4 Hours

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-757OKAX757okax00757
    • 2021-09-04
    118 min

    [AUKG-520]From Widow To Lesbian: Her Mourning Dress Arouses Her Sister-In-Law, Starring Risa Dan and Miyuki Fuji

  • rinsha dan miyuki fuji censoredbig titslesbianAUKGu krentoAUKG-520AUKG520aukg00520
    • 2021-09-09
    120 min

    [DLDSS-025]"Hey, I Want To Taste Your Cock." She Doesn"t Comply. A Beautiful Lewd Girl In A Peaceful Workplace. Suzume Mino

  • suzume mino censoredbig titsblowjobDLDSSdahliakei isoiDLDSS-025DLDSS0251dldss00025
    • 2021-09-09
    128 min

    [FGAN-047]Creampie Blooming GIrl Azusa - Azusa Misaki

  • misaki azusa censoredcreampiesingle workFGANfechi mefetish eyesFGAN-047FGAN047h-1440fgan00047
    • 2021-09-10
    120 min

    [IPX-717]112 Orgasms! 7300cc Of Squirts! A Big Ass Furious Ass-Shaking Piston-Pounding Trance Orgasmic Fuck Kotomi Ono

  • kotoyumi ono censoredsquirtingbeautiful girlIPXidea pocketinaballdishIPX-717IPX717ipx00717



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV