meat 017




FC2DASDNACRDASDWANZABWAUKSMIDVNATRFSDSSSSISHDKAVEMAMEYDLULUAUKGHZGDNNPJSSNIKBISTARS

2024-03-26
120 min

107SPLY-017 Masao Mao, A Plain And Serious OL, Actually Goes To Work!I Can Fire Infinitely With A Meat Feeling Lotion Mat

  • maofujikita censoredcreampiebig titssplysply-017sply017107sply-017
    • 2023-11-03
    155 min

    DVEH-017 Mio Nosaki, The Naughty New Wife Next Door, Tempts You With Her Lewd Meat Sticking Out Of The S-sized Clothes That Tighten Her Plump Body.

  • nozaki misakura censoredcreampiesingle workDVEHdeepsyakumaru musubideep s 3rd storeDVEH-017DVEH017dveh00017
    • 2023-07-02
    148 min

    IZM-017 A Girl Who Wants To Be Bullied By An Amateur Mr. Nakata"s Cream Pie Cake Shop Soka 21 Years Old Perverted Masochist Who Wants To Be A Lustful Meat Urinal! J Cup 120cm Colossal Breasts Obscene Powerful Body Serious Sexual Desire Of A Popul

  • nanhata sohana censoredcreampieamateurIZMplumasakusaamateur only plumIZM-017IZM017h-113izm00017
    • 2021-01-29
    239 min

    BRTM-017 "Eh, It"s A Bit Strange..." To An Amateur Girl Who Flinched, "I Have Money," Until Anal And Restraint Training! 4 Hours Of Women Who Fell To Meat Slaves With Momentum

  • amateur censoredBRTMk m producepermablack real burakku rearuBRTM-017BRTM017172brtm00017
    • 2019-06-12
    143 min

    [NINE-017]Caught An A5 Rank J Cup Amateur By Talking To A Thick Piece Of Meat With Diet Supplements As Bait

  • censoredcreampiebig titsNINEmercurychateaubriand hutNINE-017NINE017h-1133nine00017
    • 2018-12-07
    163 min

    [MEAT-017]Voluptuous Thighs In Knee-High Socks Total Domain Momo Shiraishi

  • momo shiraishi censoredsingle workMEATbig fleshy road family daydreamomaruMEAT-017MEAT017meat00017



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV