over hours school uniform def jav beautiful girl




FC2NACXNNPJNATRJUFEMARAPPPDKBIMIDVAVSAEBODAPODFSDSSCHRVHDKACESDHNDSHKDPREDMILKCAWD

2024-02-22
485 min

FCDSS-069 FALENO Special Selection! The Best Of 33 Consecutive 8 Hours Of Semen Being Squeezed Out By Female Students!

  • tokita ami angel moe censoredschoolgirlbeautiful girlFCDSSfalenofaleno starFCDSS-069FCDSS0691fcdss00069
    • 2024-02-10
    240 min

    BAZX-389 After School, Uniform Girl Will Be Delivered To You. 01 Would You Like To Play Aoharu With Me？

  • censoredcreampieuniformBAZXbazookatodoBAZX-389BAZX389bazx00389
    • 2024-02-10
    244 min

    KTRA-611 Kate Live Uniform Beautiful Girl Encyclopedia 4 Hours

  • inaba hanaoto urara censoreduniformschoolgirlKTRAk tribeKTRA-611KTRA611ktra00611
    • 2019-08-11
    242 min

    INCT-039 Sex Toys For Men This Beautiful Girl With Black Hair Is A Cum Bucket Highlights 6 Girls

  • sena ai ichinose momo censoredschoolgirlbeautiful girlINCTinnocent heroINCT-039INCT039inct00039
    • 2023-06-24
    240 min

    JKSR-596 10:00 AM What Happened To School... The Tragic Pleasures Experienced By 6 Girls 4 Hours 3

  • monami bell lara kudo censoredschoolgirlbeautiful girlJKSRbig mocalobockeypink junkieJKSR-596JKSR59657jksr00596
    • 2023-06-07
    328 min

    NPL-023 [FANZA Exclusive] [Delivery Only] Carefully Selected Erotic And Cute Beautiful Girl Limited Gachiiki POV! ! BEST

  • censoredcreampieuniformNPLmax aamateur neapolitan xNPL-023NPL023npl00023
    • 2023-05-24
    276 min

    HOISW-022 Sweet! Champion 21 Schoolgirl BEST! [Sexual Desire Ghost Special]・Schoolgirl・Gonzo・Amateur・Beautiful Girl・Acme・Uniform・Big Tits・Beautiful Breasts・Ejaculation On The Tongue・Swallowing

  • censoredbig titsschoolgirlHOISWfresh gordon mousouzokufresh gordonHOISW-022HOISW022hoisw00022
    • 2023-04-18
    112 min

    SDAB-246 "I Want To Spend More Time With A Teacher Like My Father..." Miko Kojima Spends 2 Hours Every Day With Her Students After School, A Short Time Secret Meeting

  • kojima miko censoredschoolgirlbeautiful girlSDABsod createSDAB-246SDAB2461sdab00246
    • 2023-03-21
    325 min

    SKHB-007 A Junior, A Girl In Uniform, Was Brought Into The Room And Made A Fool Of Her. 323 Minutes Of Hidden Footage Of The Whole Story Of Sex. Vol.3

  • censoreduniformschoolgirlSKHBimmediately saddleamateur bulletinSKHB-007SKHB007skhb00007
    • 2021-07-27
    240 min

    [SDAB-190]Developing Body, Uncertain Beautiful Girl 18 Years Old SOD Exclusive AV Debut Rin Momono [Get Off To Impressive 4K Video!]

  • rin momono censoredbeautiful girlSDABsod createSDAB-190SDAB190
    • 2021-05-02
    240 min

    [PKPD-143]Sugar Baby Highlights 2 18 Year Old Girls Who Are Okay With Being Fucked Raw 240 Minutes

  • minami kosaka momoe kotori censoredcreampiebeautiful girlPKPDpakopako team and pleasant friends delusion groupPKPD-143PKPD143pkpd00143
    • 2019-07-26
    240 min

    [BAZX-200]Absolutely Beautiful Young Girls In Uniform - Super Collection BEST - 240 Minutes vol. 001

  • censoredcreampieblowjobBAZXmedia stationtodobazookaBAZX-200BAZX20061bazx00200
    • 2019-07-19
    240 min

    [MBM-060]The* Nonfiction. Documentary About Beautiful Girls. The Best Episodes. [Innocent, Barely Legal Students In Uniform] 12 Girls, 4 Hours

  • censoredschoolgirlbeautiful girlMBMprestigempo selection.committeembmMBM-060MBM060118mbm00060
    • 2019-06-07
    240 min

    [ONEZ-193]Cute Beautiful Young Girl in Uniform, Shameful Sex 4 Hours

  • censoredcreampieuniformONEZprestigetodoonezONEZ-193ONEZ193118onez00193
    • 2019-05-17
    239 min

    [MDTM-518]Super Horny Girls from an Elite Girls School Show Us Their True Colors 06

  • censoredcreampieschoolgirlMDTMmedia stationsuginokispace planningMDTM-518MDTM51861mdtm00518
    • 2019-04-26
    238 min

    [MDTM-510]My Girl In Uniform. I Use The Promise Of Money To Impregnate Innocent Girls. 4 Hours

  • censoredcreampieschoolgirlMDTMmedia stationspace planningMDTM-510MDTM51061mdtm00510
    • 2018-07-25
    241 min

    [SCR-201]16 Uniformed Young Girl Filthy Fuck 4 Hours

  • censoredcreampieschoolgirlSCRgrayss crimeSCR-201SCR20112scr00201
    • 2018-07-20
    256 min

    [DOCP-064]A Schoolgirl In Uniform With An Ultra Short Miniskirt + Knee High Socks = The Ultimate Total Domain Of My Erection When She Caught Sight Of My Erection, She Got So Excited That She Started To Toy With My Cock, And Then...

  • suzu yamai shiiba mikuru censoredbeautiful girlDOCPprestigedoc premiumDOCP-064DOCP064118docp00064
    • 2018-07-13
    239 min

    [GNE-207]A Totally Beautiful Girl Gives The Ultimate Cherry Popping 2

  • sonoda mio kaname censoredbeautiful girlGNEgallopneo giftGNE-207GNE207h-479gne00207
    • 2018-07-06
    483 min

    [CDC-002]Picking Up Girls And Finding Beautiful Babes With Short Hair And Incredibly Translucent Skin 40 Girls

  • censoredbeautiful girlCDCprestigecross docCDC-002CDC002118cdc00002
    • 2018-07-06
    240 min

    [ONEZ-150]# This Beautiful Girl Who Looks Way Too Good In Uniform Is My Girlfriend Memorial Complete Best 4 Hours

  • censoredcreampiebeautiful girlONEZprestigeonezONEZ-150ONEZ150118onez00150
    • 2018-06-22
    253 min

    [BAZX-141]Total Domain: Knee-high maniacs 2

  • censoredcreampieschoolgirlBAZXmedia stationone topbazookaBAZX-141BAZX14161bazx00141
    • 2018-06-22
    479 min

    [BAZX-140]I Want To Fuck This Girl Complete Memorial Best Collection 24 Girls/480 Minutes

  • censoredamateurblowjobBAZXmedia stationbazookaBAZX-140BAZX14061bazx00140
    • 2018-05-25
    240 min

    [OKAX-375]After School Babes And Lewd Molesters 4 Hours

  • censoredschoolgirlbeautiful girlOKAXkm producedick poisonside dishesOKAX-375OKAX37584okax00375
    • 2018-05-25
    241 min

    [OKAX-383]This Is The Truth! Real Sex With Schoolgirl Babes Who Work At Underground Sex Clubs! 4 Hours

  • censoredcreampieschoolgirlOKAXkm produceside dishesOKAX-383OKAX38384okax00383
    • 2018-04-12
    241 min

    [FSKT-038]The Beautiful Girl Student We Found at the Laundromat Was Mihina Nagai. Four Hours Total With Other School Girls in Uniform

  • azumihina nagai mihina censoredbig titsschoolgirlFSKTfirst starsummaryFSKT-038FSKT038h-491fskt00038
    • 2017-12-22
    241 min

    [MDTM-315]Today, Tomorrow, And The Day After Too... My Very Own Schoolgirl Idol Who Will Let Me Creampie Her Anytime 4 Hour BEST

  • yuna himekawa sakura miyuki censoredcreampieschoolgirlMDTMmedia stationsuginokispace planningMDTM-315MDTM31561mdtm00315
    • 2017-10-27
    485 min

    [TRE-056]A Beautiful Young Girl in Uniform With Beautiful Tits Pay-For-Play BEST Beautiful Tits x Uniform Get Your Last Looks Right Here!!

  • censoredschoolgirlbeautiful girlTREprestigetreasureTRE-056TRE056118tre00056
    • 2007-12-11
    54 min

    [DNW-006]After She Puts On Her Uniform

  • censoredschoolgirlbeautiful girlDNWnaniwa bookstoredragonDNW-006DNW006428dnw00006



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV