drinking




FC2MARAAUKSAVSACHRVSQTESSISBBANMVSDNGODAWDSPRDMILKGVHCESDDASDPREDWANZFSDSSVENUNACR

2023-12-09
160 min

TNOZ-029 7P Big Orgy [swallowing 20 Sperm From An Old Man] Erotic Rich Blowjob With A Cute Face [natural Personality ◎ & Anime Voice Beautiful Girl Layer] Climax Acme With Continuous Insertion Of Thick Dick [best De M Who Drinks Up All The Semen With

  • censoredcosplaybeautiful girlTNOZall japan kameko cooperative delusional groupsecond generation brim drinking uncleTNOZ-029TNOZ029tnoz00029
    • 2023-12-08
    120 min

    IPZZ-160 They Were Friends, But After A Drinking Party, They Missed The Last Train And Ended Up Staying In A Shared Room At A Hotel For The Night, And They Ended Up Having A Relationship. . . Over And Over Again With A Male Friend Who Is Kinder Than

  • nanjo aya censoredsquirtingsingle workIPZZidea pocketbungo maedatissueIPZZ-160IPZZ160ipzz00160
    • 2023-12-02
    61 min

    HNHU-085 Individual Shooting Pick-up #Innocent Beauty #F Cup Big Nipples #Mud Sex #Immediate Cum Shot #Convulsions Climax!

  • censoredcreampiebig titsHNHUthat s rightHNHU-085HNHU085h-1658hnhu00085
    • 2023-12-01
    116 min

    JMTY-069 Tadaman File 21 Riku 25 Years Old A Record Of Drinking And Creampieing A Convenient Sex Friend

  • censoredcreampieamateurJMTYteacher delusion groupukyo lifeJMTY-069JMTY069jmty00069
    • 2023-11-25
    320 min

    HOIZ-107 Hoi Hoi Friends 07 Amateur Hoi Hoi Friends, Amateur, Gonzo, Documentary, Personal Shooting, Big Breasts, Beautiful Breasts, Waist, Drinking, Office Lady, Masochist, Sex Friend, Squirting, Wetting, Urination, Neat, Tall, Beautiful Woman, Marr

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-107HOIZ107hoiz00107
    • 2023-11-23
    125 min

    FSDSS-673 "My Husband Isn"t Here Today, So Why Don"t We Have Another Drink At Home？" I Got So Excited When I Saw My Ex-girlfriend Again At The Class Reunion, Wearing No Panties Or Bra, That I Crossed The Line.Yuko Ono

  • yuko ono censoredblowjobdramaFSDSSfalenodazai chinpofaleno starFSDSS-673FSDSS6731fsdss00673
    • 2023-11-04
    130 min

    YMDS-146 Lovey-dovey Drinking At Home, Intense Close-up Sex, The Day Mao Hamasaki Became His Girlfriend

  • hamazaki mao censoredcreampiesquirtingYMDSmomotaro video publishingyoung peachYMDS-146YMDS146ymds00146
    • 2023-12-02
    100 min

    YMDD-355 Let"s Get You Drunk! ？ A Dynamic Orgy With Influencer GALS In Ueno Ameyoko

  • censoredYMDDmomotaro video publishingpink pheromone syoung peachYMDD-355YMDD355ymdd00355
    • 2023-11-28
    265 min

    SETM-006 Circle Drinking Gonzo Leaked Video Collection BEST4 Beautiful Breasts Limited Uncut Selection

  • censoredamateurSETMsod createimagineSETM-006SETM0061setm00006
    • 2023-11-24
    210 min

    HMN-482 Don"t Let Me Make Fun Of Your Head And Dick! A One-day Confinement Panic Room To Corner A Lying Submissive Man! Peeing, Urine Drinking, Female Orgasm, Lesbianism, Big Orgy, The Craziest Woman"s Harem Creampie! ! Yui Hatano Mao Hamasak

  • yui hatano hamazaki mao censoredcreampieslutHMNbooknanzaki masakiHMN-482HMN482hmn00482
    • 2023-11-24
    150 min

    HUNTB-527 My Drunk Sister"s Pantyhose Butt Is In My Face! Her Older Sister Is A Talented And Successful Career Woman, But Her Biggest Flaw Is That She Has A Bad Drinking Habit!

  • censoredcreampieHUNTBhunterkoichi davidsonhhh groupHUNTB-527HUNTB527huntb00527
    • 2023-11-23
    148 min

    AKDL-256 [Cum Drinking Sex Friend] A Record Of Making A Slut Female College Student Swallow Cum

  • censoreddeepthroatAKDLaquinoriaquinoriaknrAKDL-256AKDL2561akdl00256
    • 2023-11-20
    98 min

    SUKE-180 [Gen Z"s Super Erotic Beautiful Big Butt] Introducing A Fresh-faced JD Who Loves Muscle Training And Is Highly Conscious! ! A Lewd Girl Who Replenishes Protein By Drinking Sperm Rather Than Protein Ww Gives A Tornado Blowjob And Ejaculat

  • amateur censoredcreampieamateursukesuke-180suke180suke-180
    • 2023-11-18
    320 min

    HOIZ-105 Hoi Hoi Cool 5 Amateur Hoi Hoi Z/Personal Shooting/Beautiful Girl/Matching App/Gonzo/Documentary/Facial/Beautiful Breasts/Neat/Drinking/Electric Massager/Squirting/2 Shots/SNS/OL/Student/Black Hair/Fair Skin/Amateur

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-105HOIZ105hoiz00105
    • 2023-11-18
    320 min

    HOIZ-106 Hoi Hoi Cute #07 Amateur Hoi Hoi Z, Beautiful Girl, Amateur, Personal Shooting, Matching App, Gonzo, SNS, Facial, 2 Shots, Masturbation, Drinking, Big Breasts, Fair Skin, Neat, Tall, Black Hair, Documentary, Electric Massager

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-106HOIZ106hoiz00106
    • 2023-11-11
    123 min

    BAB-114 Maya, Who Likes Cunnilingus With Reasonable After-sex Sex + See-through Cunnilingus

  • censoredamateurBABbabylon mousouBAB-114BAB114bab00114
    • 2023-10-27
    246 min

    HODV-21813 Picking Up Married Women ``My Husband Is At A Drinking Party Anyway...if Only For A Little While..."" On Weekend Friday Nights, Housewives Have Free Time To Stretch Their Wings.I Want To Be A Woman Instead Of A Mother Until I Get H

  • censoredcreampiebig titsHODVh m pHODV-21813HODV218135642hodv21813
    • 2023-10-21
    330 min

    HOIZ-101 Hoi Hoi Champ Vol.04 Amateur One Night Documents! “Punch” Beautiful Girl Legend! All The Erotic Besties! [Immediate Nuki Special Edition] Hoihoi Punches, Amateur Hoihoi Z, Amateur, Gonzo, Personal Shooting, Matching App, 2 Shots, Drinking, F

  • censoredamateurHOIZamateur hoihoi delusion groupHOIZ-101HOIZ101hoiz00101
    • 2023-11-11
    240 min

    YLWN-284 Selfie. Home Drinking Party! Recording Of Good-natured NTR Tipsy Sex Without Permission! 4 Hours

  • censoredamateurYLWNyellow moonpatpong tateishiYLWN-284YLWN284ylwn00284
    • 2023-11-11
    39 min

    fc2-ppv 4012709 [No] Big Breasts Explosive G Cup JD! After A Drinking Party, We Went Straight To Karaoke In A Private Room. Being Played With By A Younger Man, He Ejaculates. A Must-see For Fans Of Amazing Titty Fuck Big Breasts! ! FC2-PPV-4012709

  • amateur uncensored
    • 2023-11-11
    320 min

    HOIZ-103 Hoi Hoi Home Let"s Do It At Home 15 Amateur Hoi Hoi SH, Amateur, Personal Shooting, Gonzo, Documentary, Big Tits, Beautiful Woman, Squirting, Take Home, Breaking Down, Older Sister, Titty Fuck, Electric Massager, Matching App, Facial, Dr

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-103HOIZ103hoiz00103
    • 2023-11-10
    120 min

    HUNTB-603 "Doesn"t It Feel Good For Us？" Two Young Women Who Missed Their Marriage Period Have A Huge Orgy Where Their Libido Explodes With Alcohol! ？ We Were Just Being Exploited And Had Sex Until Morning...

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-603HUNTB603huntb00603
    • 2023-11-10
    160 min

    HUNTB-724 "older Sister! I Can Not Take It Anymore! I Can"t Get An Erection! ”I Had A Drink At Home With My Two Serious Glasses-wearing Big-breasted Sisters-in-law, And They Made Me Cum Over And Over Again With A Big-breasted Sandwich And A D

  • censoredcreampieHUNTBhuntervolvo nakanohhh groupHUNTB-724HUNTB724huntb00724
    • 2023-11-10
    120 min

    ROE-187 A Night Spent Drinking With My Beloved Mother. I Became An Adult Addicted To Drinking And Squirting. Maki Tomoda

  • maki tomoda censoredsquirtingmomROEmadonnahiroyuki kimuramonroeROE-187ROE187roe00187
    • 2023-11-10
    120 min

    FOCS-160 A Dialect Girl I Met While Picking Up Girls In Aomori. A Defenseless Country Girl At Her Parents" House Squirting And Having Sex With Ai Nonose.

  • nonose ai censoredcreampiesquirtingFOCSabc delusion groupfocusFOCS-160FOCS160focs00160
    • 2023-11-09
    180 min

    AKDL-254 [Cum-drinking Saffle] A Junior At Work Loves Sperm And Makes Me Swallow It All The Time.

  • censoreddeepthroatAKDLaquinoriaquinoriaknrAKDL-254AKDL2541akdl00254
    • 2023-11-08
    44 min

    HSDAM-003 I Investigated The Kissing Demon Circumstances Of People Passing By On The Street... And Then! It Was Much Deeper Than I Expected, And It Covered My Entire Body.One Day In June, Around Takadanobaba Station, Nanoka (20)

  • censoredamateurslutHSDAMsod createkissiesod amateurHSDAM-003HSDAM0031hsdam00003
    • 2023-11-04
    320 min

    HOIZ-102 Hoi Hoi Punch 32nd Amateur Hoi Hoi Z/Personal Shooting/Beautiful Girl/Matching App/Gonzo/Amateur/Beautiful Breasts/Slender/Drinking/Big Breasts/Dirty Talk/Squirting/Muslim/Electric Massager/Student/Neat/Older Sister/Natural/SNS・Back Account

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-102HOIZ102hoiz00102
    • 2023-11-03
    160 min

    LULU-252 After Coming Back From A Drinking Party, I Let A Plain-looking Lady With Natural Big Breasts Stay At My House, And When I Tried To Pamper Her With My Young Subordinate"s Dick, She Turned Out To Be Horny And Crazy About Sex, So I Ejaculat

  • ena koume censoredcreampiesingle workLULUlunaticsluminaxLULU-252LULU252lulu00252
    • 2023-11-03
    160 min

    LULU-250 The Proud Beautiful Wife Was Her Father"s Pacifier Mistress... Yuri Sasahara, A Big-ass Cum-drinking Wife Who Swallows Middle-aged Sperm From Morning Till Night With An Exquisite Blow Job That She Won"t Give To Me.

  • yuri sasahara censoredcreampiesingle workLULUlunaticsvragmanLULU-250LULU250lulu00250
    • 2023-10-31
    115 min

    016DHT-0846 Scramble! Eat Each Other! Mature Woman Group Date NEO Drink! Make Some Noise! Let"s Do It! This Is A Drinking Party For Adults! ! 04

  • amateur censoredcreampieamateurdhtdht-0846dht0846016dht-0846
    • 2023-10-29
    79 min

    fc2-ppv 3969122 *Brush Wholesale [Sold Out] Vtuber Rize Hell Star (Idol Ver.) Fluffy Gcup Cosplay Titty Fuck With Two Consecutive Creampies. Virgin Boy"s Best Creampie Graduation FC2-PPV-3969122

  • amateur uncensoredcreampie
    • 2023-10-22
    156 min

    MOON-013 Even Though Her Husband Was Nearby, She Unexpectedly Swallowed The Sperm In Her Mouth And Started Drinking It Every Time They Met, Saying It Was A Commemoration Of Their Affair. Kana Morisawa

  • kana morisawa kanako iioka censoredsingle workdramaMOONyonakatanaka baconMOON-013MOON0131moon00013
    • 2023-10-22
    225 min

    SUN-100 Uterus Picking Semen Drinking Date With Creampie Cum Swallowing Every Drop From The Upper And Lower Mouth

  • censoredcreampieSUNsunSUN-100SUN1001sun00100
    • 2023-10-21
    116 min

    AGAV-094 Every Time She Squirts, She Swallows Semen. Sae Fujiki, A Big-breasted Married Woman Who Was Kidnapped And Imprisoned By A Cum-drinking Maniac.

  • sae fujiki censoredsquirtingsingle workAGAVsex agentaoi buttonAGAV-094AGAV094agav00094
    • 2023-10-21
    171 min

    SCPX-483 Cuckold Documentary Boyfriend & Girlfriend + Boyfriend"s Home Drinking Party Gets Exciting... When The Boyfriend Gets Drunk, There Is A 120 Chance That The Drunk Girlfriend Will Cheat On Him Next To The Sleeping Boyfriend.

  • censoredcreampieSCPXscoopSCPX-483SCPX483scpx00483
    • 2023-10-21
    130 min

    PKGP-005 Creampie Room Drinking Document Perfect Beautiful Actress With Natural G Cup Emi Nishino

  • nishino emi censoredcreampiebig titsPKGPpakopako team and pleasant friends delusion groupPKGP-005PKGP005pkgp00005
    • 2023-10-17
    142 min

    SDAM-082 A Female College Student Who Works Part-time At A Warehouse Will Immediately Take Care Of You If Something Goes Wrong During Sorting Work. She Is Plain Looking And Vulgarly Vacuumed. Moreover, She Is OK With Drinking Semen. Tsubasa 22 Years

  • censoredcreampieSDAMsod createinoue japansod amateurSDAM-082SDAM0821sdam00082
    • 2023-10-16
    125 min

    MXGS-1305 I Cuckolded My Best Friend"s Drunk Girlfriend And Creampied Her, Erika Ozaki.

  • ozaki erika censoredcreampieblowjobMXGSmaxingMXGS-1305MXGS1305h-068mxgs01305
    • 2023-10-15
    38 min

    fc2-ppv 3928224 [#Cum-drinking Half-beauty] Erika (27), Who Works In The Medical Field, Is Made To Drink Semen And Her Sensitivity Explodes. Wide Leg Orgasm Succumbing To Cock Marking FC2-PPV-3928224

  • amateur uncensoredamateur



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV