miniskirt




FC2ROYDAPODVENXCAWDCHRVKBIFSDSSRBDJUFEGMEMWAAAMVSDSANDASDMIDVHMNSTARSHNDSHKDHUNTB

2019-08-08
170 min

[SW-648]The Young Ladies In My Hometown Walk Around With Their Big Sexes Asses Almost Falling Out Of Their Miniskirts. I Tried Taking A Peek, And The Girls Actually Got Excited, Practically Begging Me To Ram My Hard Cock Inside Them!

  • censoredSWswitchyocchanswitch switchSW-648SW6481sw00648
    • 2019-08-02
    146 min

    [HODV-21399]I Did The Girl Next Door On My Summer Vacation Stand By Me Sakura Kirishima

  • kirishima sakura censoredcreampiebig titsHODVh m phassyHODV-21399HODV213995642hodv21399
    • 2019-07-25
    117 min

    [GS-273]My Cock Gets Commandeered By A Sexy Scary Lady! The Woman Who Lives Upstairs Is Beautiful, But She Never Says Hello To Me. I Can See Up Her Miniskirt When She Walks Up The Stairs, But Is She Showing Me Her Panties On Purpose...？

  • censoredcreampieGSsosoru x garconspada ikebukuroGS-273GS2731gs00273
    • 2019-07-13
    119 min

    [SSNI-521]Nympho Teacher Sleeps With Parents & Guardians In Miniskirt Temptation

  • nine yoshitaka censoredslutsingle workSSNIs1 no 1 stylekyoseiSSNI-521SSNI521ssni00521
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-11
    180 min

    [SW-640]When My Parents Got Remarried, I Got Some Little Devil Sisters-In-Law Who Were Luring Me To Miniskirt Panty Shot Temptation! I Was Always An Only Child, But Now, These Girls Were Living Under The Same Roof As Me, And Showing Off By Changing I

  • censoredsisterSWswitchyocchanswitch switchSW-640SW6401sw00640
    • 2019-07-08
    125 min

    [ARM-780]The Ultimate Complete POV Masturbation Support DVD. 3 G-String Provocations. Aromatic Jerk-Off Instruction

  • hoshino leia ikuta miku censoredanalARMaroma planningaromaARM-780ARM780arm00780
    • 2019-07-08
    141 min

    [ARM-778]You Can Even See The Shape Of Her Clit! Orgasmic Panty Soaking Masturbation 4

  • kiriyama yuu kuraki bookmark censoredARMaroma planningaromaARM-778ARM778arm00778
    • 2019-07-08
    109 min

    [ARM-779]Her Young Thighs Milk Middle-Aged Balls Dry. Thigh-Job By A Girl 20 Years Younger Than Me.

  • miho yui satori fujinami censoredschoolgirlslutARMaroma planningaromaARM-779ARM779arm00779
    • 2019-07-04
    176 min

    [AP-673]Tight Skirt Train Molester

  • censoredbukkakeAPapachemasanorihhh groupAP-673AP673ap00673
    • 2019-06-27
    146 min

    [SPRD-1162]Father With Son's Wife Kanna Abe

  • rena abe censoredsingle workdramaSPRDtakara eizokon oriharualeddinSPRD-1162SPRD116218sprd01162
    • 2019-06-20
    171 min

    [SW-637]"My Father-In-Law's Always Looking At My Panties! Since My Husband Won't Have Sex With Me, I'm Gonna Get My Father-In-Law To Fuck Me!" Forbidden Relations With Her Father-In-Law After Giving Him A Boner With Panty Shots. H

  • censoredSWswitchyocchanswitch switchSW-637SW6371sw00637
    • 2019-06-14
    130 min

    [SCG-003]#SuperLaidBack 03. Mai

  • censoredamateurSCGprestigestrawberry cats goldSCG-003SCG003118scg00003
    • 2019-06-14
    120 min

    [MDTM-531]"You Can Do It! Try To Cum 10 Times in a Row!" Pep Talk Sex With Big-Titted Cheergirl Sana Matsunaga vol. 001

  • sana matsunaga censoredcreampiebig titsMDTMmedia stationtodouchu kikakuMDTM-531MDTM53161mdtm00531
    • 2019-06-06
    114 min

    [GS-263]This Girl In A Miniskirt Came Out To The Waiting Room After Finishing Her Medical Examination, And I Could Tell, Something Was Off... Maybe She Was Feeling Woozy From Some Kind Of Medicine, Because She Was Wobbling And Exposing Her Panties! S

  • censoredGSsosoru x garconjulianoGS-263GS2631gs00263
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-06-06
    225 min

    [SW-635]The Knee-High Socks And Thighs I See Every Morning. The Panty-Shot Schoolgirl Was So Cute, She Was Giving Me A Boner. "You Dirty Man." She Puffed Her Cheeks And Looked At Me Angrily. But She Quickly Started To Stare At Me With Teary E

  • arimura nozomi censoredsingle workSWswitchlight fujimaswitch switchSW-635SW6351sw00635
    • 2019-06-03
    64 min

    [KWP-002]Her Sexy Ass In 20-Denier See-Through Pantyhose Mao Hamasaki

  • hamazaki mao censoredsingle workKWPk westk westpsKWP-002KWP002h-1339kwp00002
    • 2019-05-31
    240 min

    [OKAX-511]Real Peeping Infiltrating Costume Whorehouse Where Sex Is Not Allowed 15 Women 4 Hours

  • censorednurseOKAXkm producedick poisonside dishesOKAX-511OKAX51184okax00511
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2019-05-23
    100 min

    [GS-260]I Was Unexpectedly Turned On By The Sight Of This Sch**lgirl In Her Uniform, Standing At The Bookstore And Browsing In Her Short Skirt, So I Found Myself Peeping Some Panty Shot Action. But Seriously, She Didn't Catch On To Me, So I Went

  • censoredcreampieschoolgirlGSsosoru x garconikebukuro store managerGS-260GS2601gs00260
    • 2019-05-17
    122 min

    [NASH-066]This Old Lady Is Wearing A Tight Skirt Wrapped Around Her Beautiful Legs This Devilish MILF Is Tempting You With Panty Peeks Of Her Voluptuous Thighs And Meaty Ass

  • censoredmature womanNASHpinknadeshikoNASH-066NASH066h-067nash00066
    • 2019-05-11
    150 min

    [002HODV-21378]綺麗なママのいやらしい尻 成海さやか

  • amateur censoredmarried womanamateurhodvhodv-21378hodv21378002hodv-21378
    • 2019-05-09
    150 min

    [SW-628]This Neighborhood Wife Is Wearing A Miniskirt And Now Her Beautiful Big Ass Is Staring Me In The Face On The Stairs! I Don't Know If She's Doing It On Purpose Or Unconsciously But She's Thrusting Out That Panty Shot Action At Me,

  • censoredSWswitchyocchanswitch switchSW-628SW6281sw00628
    • 2019-04-26
    55 min

    [KWP-001]Bubble Butt Babe In 20 Denier Transparent Pantyhose Asahi Mizuno

  • mizuno chaoyang censoredsingle workKWPk westk westpsKWP-001KWP001h-1339kwp00001
    • 2019-04-25
    160 min

    [SW-625]"Don't Tell Me That You Have Sexual Feelings For My Daughter, Do You？" My Wife's 3 Daughters Were Little Devils Who Were Luring Me To Temptation Wearing Ultra Short Miniskirt Outfits And Flashing Panty Shot Action At Me! From

  • censoredSWswitchyocchanswitch switchSW-625SW6251sw00625
    • 2019-04-25
    129 min

    [SW-627]She Was On A Crowded Bus And Her Husband Was Standing Next To Her While Another Man's Cock Kept Rubbing Against Her Ass, And Each Time It Touched Her, Her Excitement Went Up Another Notch. When This Erect Cock Reacted To Her Voluptuous Mi

  • censoredSWswitchtakeshi yamashiroswitch switchSW-627SW6271sw00627
    • 2019-04-05
    176 min

    [DOCP-140]I Couldn't Control The Thrill I Felt From The Total Domain Peeking Out From Underneath Her Miniskirt... 2

  • ayu saito mai tominaga censoredDOCPprestigedoc premiumDOCP-140DOCP140118docp00140
    • 2019-03-07
    120 min

    [KCDA-251]21 Face Sitting Miniskirt-Wearing Office Ladies Are Toying With Men, One After Another

  • censoredbig titsslutKCDAdigital arkdigital ark digital arkKCDA-251KCDA251kcda00251
    • 2019-03-07
    160 min

    [SW-616]I Met My First Love At A Reunion And She's A Married Woman Now! Sexually Unsatisfied By Her Husband, She Tempts Me With Panty Shots And She Even Grabs My Hard Dick Under The Table. I Have No Choice But To Secretly Fuck Her Right There In

  • censoredSWswitchyocchanswitch switchSW-616SW6161sw00616
    • 2019-03-07
    119 min

    [GS-247]Going On A Paid Date With My Boss's Pushy Daughter!？ My Boss's Daughter Came To The Office But Her Father Had Already Gone Home. When I Told Her... She Wouldn't Go Home. And Her Miniskirt And Panty Shots Were Making My Dick Hard..

  • censoredGSsosoru x garconjulianoGS-247GS2471gs00247
    • 2019-02-22
    245 min

    [NASH-018]This Lady Boss Called Her Idiot Employee On To The Carpet And Tore Him A New Asshole But When It's Just The Two Of Them Together She Turns Into A Sexy Lady Who Turns On The Charm And Lures Him To Temptation With Her Sweet Voice

  • censoredbig titsuniformNASHpinknadeshikoNASH-018NASH018h-067nash00018
    • 2019-02-21
    141 min

    [SW-615]At The Bookstore, This Hard-Working Student Was Suddenly Assaulted By Married Woman Panty Shot Action! He Was Searching For A Reference Manual But She Shoved Some Erotica In His Face And Now He Was Sorely Confused. As Her Panty Shot And Nip S

  • censoredSWswitchtakeshi yamashiroswitch switchSW-615SW6151sw00615
    • 2019-02-20
    128 min

    [ARM-741]This Elder Sister With Beautiful Legs Has Me On My Hands And Knees And Unable To Move While She Gives Me A Footjob

  • shinoda yu kanae lennon censoredslutARMaroma planningaromaARM-741ARM741arm00741
    • 2019-02-19
    91 min

    [DOKI-007]I Can't Believe I'm Sharing A Hotel Room With The Hot Office Girl 2

  • mayu harada censoredbig titsblowjobDOKIolstuck softolstuck picturesDOKI-007DOKI0075561doki00007
    • 2019-02-07
    193 min

    [DANDY-647]"Go Ahead And Jack Off While Staring At My Panties" The Patient In The Hospital Bed Next To Mine Has A Girlfriend Who Keeps Coming Over And Teasing Me With Panty Shot Action Because She's A Horny Slut vol. 2

  • censoredslutDANDYdandyparsley okamotoDANDY-647DANDY6471dandy00647
    • 2019-01-26
    169 min

    [MIAA-013]We Like To Target Those Off-Periods! A Healthy And Wholesome Massage Parlor Is Empty During Weekday Afternoons So You Can Have The Whole Place To Yourself! This Prim And Proper Massage Parlor Therapist Doesn't Like My Dirty Jokes, But W

  • mihara honoka rino kirishima censoredhandjobMIAAmoodyzzaku araieveryone s porn starMIAA-013MIAA013miaa00013
    • 2019-01-26
    119 min

    [MIAA-012]This Miniskirt Wearing Girl Likes To Tease You By Rubbing Her Panties Against Your Cock And Letting You Enter Through Her Sheer Fabric The Temptation Of 1.2cm Of Fabric Akari Mitani

  • mitani akari censoredschoolgirlbeautiful girlMIAAmoodyzsuisei akaieveryone s porn starMIAA-012MIAA012miaa00012
    • 2019-01-26
    155 min

    [MIDE-621]Living With Yukina, The Girl In A Miniskirt Who Adores You. Yukina Shida

  • yukina shida censoredbeautiful girlMIDEmoody szampamoodyz divaMIDE-621MIDE621mide00621



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV