sis




FC2CAWDSSNIADNMIDVHODVMARACHRVNATRNNPJFSDSSHDKAMILKDTTDASDSQTEDASDPPPDSDABMEYDRBD

2020-03-01
110 min

[SIS-110]Elder Sister Night Visit Creampie Peeping R**e

  • censoredcreampiesisterSISglay zno directorsisterSIS-110SIS11012sis00110
    • 2020-02-01
    113 min

    [SIS-108]I'm Not Your Little Stepbrother Anymore... -Crazy Rough Fuck Stepbrother Diaries- Nagi Asakura

  • asakura censoredcreampiebig titsSISglay zno directorsisterSIS-108SIS10812sis00108
    • 2020-01-25
    167 min

    [WANZ-930]Wait... Step-Sis？! Mistaking Her For My Girlfriend I Slipped It In. Turned On By My Sudden Hard Cock, She Wouldn't Stop Until She Got A Creampie (Julia)

  • julia censoredcreampiebig titsWANZones factoryno directorwanzWANZ-930WANZ930wanz00930
    • 2020-01-01
    127 min

    [SIS-107]Stepbrother's Hard Cock Spotted! Forbidden Daydream Masturbating Stepsister's Shame!

  • rena abe shiina honoka censoredcreampiesisterSISglay zsisterSIS-107SIS10712sis00107
    • 2019-12-01
    240 min

    [SIS-106]My Stepsister Wants To Lose Weight, But I Love Her Chubby Body, So I'm Definitely Going To Fuck Her While I Have The Chance - 4 Hours

  • censoredcreampiebig titsSISglay zsisterSIS-106SIS10612sis00106
    • 2019-11-02
    187 min

    [HUNTA-676]I Was Practicing Some Hard Deep Throat Piston Pumping Action With My Pushover Little Sister-In-Law, When She Got Her Pussy So Dripping Wet That She Started To Massively Stain Her Panties!! I Had Just Finished Unloading My Cock Into Her Thr

  • censoredsisterdeepthroatHUNTAhuntermorikihhh groupHUNTA-676HUNTA676hunta00676
    • 2019-10-01
    111 min

    [SIS-104]Even Though She's His Stepsister... Fucked By Her Younger Stepbrother During Their Last Hot Spring Trip - Sayuri Natsume (32 Years Old)

  • sayuri natsume censoredcreampieblowjobSISglay zsisterSIS-104SIS10412sis00104
    • 2019-10-01
    240 min

    [SIS-105]Stepsister Sex 4 Hours - A Video Record Of A Little Stepbrother's Daydream Fantasies Of Fucking His Big Stepsister -

  • censoredcreampiebig titsSISglay zsisterSIS-105SIS10512sis00105
    • 2019-09-16
    115 min

    [EKDV-596]Whenever She Sees My Face, My Elder Sister-In-Law Shows Off Her G-Cup Big Tits And Lures Me To Temptation Tsugumi Morimoto

  • tsugumi morimoto censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-596EKDV59649ekdv00596
    • 2019-08-23
    102 min

    [YSN-486]Beautiful Muscular Big Sis' Slutty Workout - Yuka Sawahara

  • yuka sawahara censoredcreampieblowjobYSNnonYSN-486YSN486h-127ysn00486
    • 2019-08-23
    59 min

    [WFR-006]Big Sis Felt Horny After Work, Got Wet The Whole Way And Went Crazy - Mao Hamasaki

  • hamazaki mao censoredsquirtingblowjobWFRwaap entertainmenttonkatsuwWFR-006WFR0062wfr00006
    • 2019-07-20
    122 min

    [HND-697]Filthy Big Sis With Super Hot Nipples Squeezes Her Vagina to Invite A Creampie Shiori Kamisaki

  • shiori kamisaki censoredcreampiebig titsHNDhon nakamiyoshi rusherHND-697HND697hnd00697
    • 2019-07-01
    480 min

    [SIS-100]8 Hours Of Incestuous Creampie Sex Videos ~Dirty Sex With My Hot Stepsisters At Home~

  • censoredcreampieslutSISglay zsisterSIS-100SIS10012sis00100
    • 2019-05-19
    154 min

    [HND-674]Secret Babymaking Life With Little Step Sister Who Loves Me Too Much Satori Fujinami

  • satori fujinami censoredcreampiebeautiful girlHNDhon nakausa pyonHND-674HND674hnd00674
    • 2019-05-01
    119 min

    [SIS-097]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 16

  • kuraki bookmark hoshisaki mica censoredcreampiesisterSISglay zsisterSIS-097SIS09712sis00097
    • 2019-04-01
    121 min

    [SIS-096]This Big Sister Wants Her Little Brother To Rape Her Maika Hoshisaki

  • hoshisaki mica censoredcreampiebig titsSISglay zsisterSIS-096SIS09612sis00096
    • 2019-03-01
    241 min

    [SIS-095]Drunk Girl Big Sister Obscene Sleeping Rape 4 Hours

  • censoredcreampiebig titsSISglay zsisterSIS-095SIS09512sis00095
    • 2019-03-01
    224 min

    [DOCP-130]Big Brother Watches Porn With The Sound On Even Though His Little Sister Is Asleep Next To Him. When His Little Sister Realizes What Is Happening She Tries To Pretend Like She Didn't Notice But Her Nether Region Has A Mind Of Its Own

  • suzu yamai tomomi hoshisaki censoredcreampiesisterDOCPprestigedoc premiumDOCP-130DOCP130118docp00130
    • 2019-02-01
    200 min

    [DOCP-125]I Mistook My Girlfriend's Little Sister For My Girlfriend And Insta-Fucked Her!？ I Only Realized After I Came. I Apologized Profusely But My Girlfriend's Sister Was Already Turned On And She Carried On Fucking Me, Orgasming Over And

  • bubble yuuki hinami yumezaki censoredcreampiebig titsDOCPprestigedoc premiumDOCP-125DOCP125118docp00125
    • 2019-01-17
    183 min

    [HUNTA-541]My Big Sis Liked It So Much When I Ate Her Out For The First Time, She Came While Squeezing Me Like A Kamakiri ! My Shy, Late-Blooming Older Sister Starting Acting Weird Once She Finally Got A Boyfriend. That's When She Suddenly Asked

  • censoredsisterHUNTAhuntercognac kaminohhh groupHUNTA-541HUNTA541hunta00541
    • 2019-01-01
    241 min

    [BUR-521]A Video Posting By A Big Brother Who Is Raping His Little Sister 4 Hours

  • censoredcreampieschoolgirlBURgraysburstBUR-521BUR52112bur00521
    • 2019-01-01
    122 min

    [SIS-094]"Help! I Came Too Much And Now My Vibrator Won't Come Out!" A Desperate Older Sisters Turns To Her Brother For Help

  • kamikawa starry sky aki sasaki censoredcreampieslutSISglay zsisterSIS-094SIS09412sis00094
    • 2018-12-01
    241 min

    [SIS-093]A Little Brother Who Has Forbidden Sex With His Hot And Horny Big Sisters In This Incest Video 4 Hours

  • censoredcreampiebig titsSISglay zsisterSIS-093SIS09312sis00093
    • 2018-11-01
    119 min

    [SIS-092]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 15

  • sena kirari aoi mizutani censoredcreampiesisterSISglay zsisterSIS-092SIS09212sis00092
    • 2018-10-27
    171 min

    [MIDE-592]The Total Domain Temptation Of A Super Horny Elder Sister In Knee-High Socks Tsubomi

  • bud censoredcosplayslutMIDEmoodyzhirokoji osakimoodyz divaMIDE-592MIDE592mide00592
    • 2018-10-05
    209 min

    [DOCP-093]"You Were Thinking Of Me, Weren't You...？" My Sister Came To Stay With Me. Her Tits Had Grown In The Few Years I Hadn't Seen Her, I Couldn't Control Myself. I Was Secretly Masturbating While She Was Sleeping, When She Gr

  • natsuko mishima sakura chinami censoredbig titssisterDOCPprestigedoc premiumDOCP-093DOCP093118docp00093
    • 2018-09-24
    117 min

    [SIS-091]Sister Night Visit Creampie Peeping Rape SIS- 091

  • haruka mirai rena abe censoredcreampiesisterSISgrayssisterSIS-091SIS09112sis00091
    • 2018-07-22
    120 min

    [XVSR-400]Naughty Creampie Life With Horny Big Sis Who's Crazy About Her Brother Yui Hatano

  • yui hatano censoredcreampieXVSRmax asono kancalenXVSR-400XVSR400xvsr00400
    • 2018-06-24
    119 min

    [SIS-088]Incestuous Cheating - Brother Fucks Sister Next to Her Boyfriend

  • shiiba mikuru oba yui censoredcreampiebig titsSISgrayssisterSIS-088SIS08812sis00088
    • 2018-06-12
    117 min

    [KTRA-036]My Little Sis -- a Tiny Body with Giant Tits

  • ann wakamoto censoredbig titsbeautiful girlKTRAk tribeKTRA-036KTRA036h-094ktra00036
    • 2018-06-10
    128 min

    [KRAY-023]Drowning In Titties A Big Tits Elder Sister With Over H Cup Titties In Excessively Loving Sex

  • nene sakura waka ninomiya censoredbig titslingerieKRAYs cuteKRAY-023KRAY023kray00023
    • 2018-06-08
    116 min

    [ARM-680]After Getting A Sexy Thigh Job By An Elder Sister That Brought My Cock To Its Rock Hard Limit, May I Stick It In Now？

  • mizuno chaoyang mizuki nagamine censoredmarried womanARMaroma planningaromaARM-680ARM680arm00680
    • 2018-04-24
    116 min

    [SIS-084]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 13

  • rena abe censoredcreampiesisterSISglayzupdatingSIS-084SIS08412sis00084
    • 2018-03-25
    103 min

    [SIS-082]A Big Sister With A Brother Complex Is Getting Horny For Her Little Brother's Cock

  • aki sasaki censoredcreampieslutSISglayzupdatingSIS-082SIS08212sis00082
    • 2018-02-16
    240 min

    [HUNTA-410]"Let Your Big Sis Cure You Of Your Premature Ejaculation!" I Suddenly Got A Cute New Big Sister-In-Law With A Hot Body I Wasn't Used To Living With A Girl, But She Dressed So Scandalously That I Couldn't Turn Away! I've

  • censoredlingerieHUNTAhunterkawajirihhh groupHUNTA-410HUNTA410hunta00410
    • 2018-01-25
    122 min

    [SIS-079]The Opening Of A Sex Club!？ My Big Sister Is Opening A Sex Club At Our House! And Her Best Customer Is Her Little Brother, Me, Every Day! Aki Sasaki

  • aki sasaki censoredcreampieslutSISgrayssisterSIS-079SIS07912sis00079
    • 2018-01-25
    126 min

    [SIS-077]I Rang Up A Call Girl And My Sister Showed Up! In The End She Let Me Give Her A Creampie (Against The Rules) 12

  • sena ai narumi sayaka censoredcreampiebig titsSISgrayssisterSIS-077SIS07712sis00077
    • 2018-01-25
    126 min

    [SIS-078]Incestuous Creampie Sex with Yuzu, my Charming, Oversexed Classmate/Stepsister with a Shaved Pussy, and Arisa, My Big Sister with Huge Tits and a Brother Complex

  • yuzu kitagawa arisa hanyu censoredcreampiebig titsSISglayzupdatingSIS-078SIS07812sis00078
    • 2018-01-11
    181 min

    [SW-530]A Big Sis Shotacon My Big Titty Big Sisters Are Teaching My Naughty Cock A Sex Lesson! "You've Got A Big Cock For A Little Kid!" My Horny Big Sisters Were Happy To Make Me Squirt My Hot White Semen Into Them, Over And Over Again

  • censoredbig titssisterSWswitchyocchanSW-530SW5301sw00530
    • 2017-09-24
    98 min

    [SIS-070]This Little Brother Was Teased For Being A Cherry Boy, So He Filmed These Immoral Peeping Videos Of His Beautiful Big Sister

  • censoredcreampiesisterSISgrayssisterSIS-070SIS07012sis00070



    • Japan xxx movies, Jav xxx movs, Javxxx, Japanese adult videos, Jav streaming online, Free download JAV